KEGG   Homo sapiens (human): 11074Help
Entry
11074             CDS       T01001                                 

Gene name
TRIM31, C6orf13, HCG1, HCGI, RNF
Definition
(RefSeq) tripartite motif containing 31
  KO
K12011  tripartite motif-containing protein 31 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    11074 (TRIM31)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     11074 (TRIM31)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    11074 (TRIM31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_4 zf-B_box zf-C3HC4 zf-RING_UBOX zf-C3HC4_2 zf-C3HC4_3 zf-RING_2 zf-RING_6 zf-RING_5 Baculo_IE-1 Prok-RING_4 NIBRIN_BRCT_II Phage_integrase
Motif
Other DBs
NCBI-GeneID: 11074
NCBI-ProteinID: NP_008959
OMIM: 609316
HGNC: 16289
Ensembl: ENSG00000204616
Vega: OTTHUMG00000031064
Pharos: Q9BZY9(Tbio)
UniProt: Q9BZY9 Q2L6J1
Structure
PDB: 

Position
6p22.1
AA seq 425 aa AA seqDB search
MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSV
RKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRES
KDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQR
ILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQN
MPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQAD
RKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHS
LFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFC
EVPSS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgggcagtttgtgaacaaactgcaagaggaagtgatctgccccatctgcctg
gacattctgcagaaacctgtcaccatcgactgtgggcacaatttctgcctcaaatgcatc
actcagattggggaaacatcatgtggatttttcaaatgtcccctctgcaaaacttccgta
aggaagaacgcaatcaggttcaactcgctgttgcggaatctggtggagaaaatccaagct
ctacaagcctctgaggtgcagtccaaaaggaaagaggctacatgcccgaggcaccaggag
atgttccactatttctgcgaggatgatgggaagttcctctgttttgtgtgtcgtgaatcc
aaggaccacaaatcccataatgtcagcttgatcgaagaagctgcccagaattatcagggg
cagattcaagagcagatccaagtcttgcagcaaaaggagaaggagacagtacaagtgaag
gcacaaggtgtacacagggtcgatgtcttcacggaccaggtagaacatgagaagcaaagg
atcctcacagaatttgaactcctgcatcaagtcctagaggaggagaagaatttcctgcta
tcacggatttactggctgggtcatgagggaacggaagcggggaaacactatgttgcctcc
actgagccacagttgaacgatctcaagaagctcgttgattccctgaagaccaagcagaac
atgccacccaggcagctgctggaggatatcaaagtcgtcttgtgcagaagtgaagagttt
cagtttctcaacccaacccctgttcctctggaactggagaaaaaactcagtgaagcaaaa
tcaagacatgactccatcacagggagcctaaaaaaattcaaagaccaactccaggctgat
aggaaaaaagatgaaaacagattcttcaaaagcatgaataaaaatgacatgaagagctgg
ggcttgttacagaaaaataatcataaaatgaacaaaacctcagagcccgggtcatcttct
gcaggcggcagaactacatcggggccaccaaatcaccactcttcagccccatcccactcc
ctgtttcgggcctcgtctgctgggaaagtcacttttccagtatgtctcctggcctcttat
gatgagatttctggtcaaggagcgagctctcaggatacgaagacatttgacgttgcgctg
tccgaggagctccatgcggcactgagtgagtggctgacagcgatccgggcttggttttgt
gaggttccttcaagctaa

DBGET integrated database retrieval system