KEGG   Homo sapiens (human): 1109
Entry
1109              CDS       T01001                                 

Gene name
AKR1C4, 3-alpha-HSD, C11, CDR, CHDR, DD-4, DD4, HAKRA
Definition
(RefSeq) aldo-keto reductase family 1 member C4
  KO
K00037  3alpha-hydroxysteroid 3-dehydrogenase / chlordecone reductase [EC:1.1.1.50 1.1.1.357 1.1.1.225]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Network
nt06022  Bile acid biosynthesis
  Element
N00805  Bile acid biosynthesis
N00806  ACOX2 deficiency in bile acid biosynthesis
N00807  AMACR deficiency in bile acid biosynthesis
N00808  CYP27A1 deficiency in bile acid biosynthesis
Disease
H00607  46,XY gonadal dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    1109 (AKR1C4)
   00140 Steroid hormone biosynthesis
    1109 (AKR1C4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.50  3alpha-hydroxysteroid 3-dehydrogenase (Si-specific)
     1109 (AKR1C4)
    1.1.1.225  chlordecone reductase
     1109 (AKR1C4)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     1109 (AKR1C4)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 1109
NCBI-ProteinID: NP_001809
OMIM: 600451
HGNC: 387
Ensembl: ENSG00000198610
Vega: OTTHUMG00000017591
Pharos: P17516(Tbio)
UniProt: P17516
Structure
PDB: 
2FVL

Position
10p15.1
AA seq 323 aa
MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPM
ALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKP
GLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPVLLEDPV
LCALAKKHKQTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLN
RNYRYVVMDFLMDHPDYPFSDEY
NT seq 972 nt   +upstreamnt  +downstreamnt
atggatcccaaatatcagcgtgtagagctaaatgatggtcacttcatgcccgtattggga
tttggcacctatgcacctccagaggttccgaggaacagagctgtagaggtcaccaaatta
gcaatagaagctggcttccgccatattgattctgcttatttatacaataatgaggagcag
gttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattc
tacacttcaaagctttggtgcactttctttcaaccacagatggtccaaccagccttggaa
agctcactgaaaaaacttcaactggactatgttgacctctatcttcttcatttcccaatg
gctctcaagccaggtgagacgccactaccaaaagatgaaaatggaaaagtaatattcgac
acagtggatctctctgccacatgggaggtcatggagaagtgtaaggatgcaggattggcc
aagtccatcggggtgtcaaacttcaactgcaggcagctggagatgatcctcaacaagcca
ggactcaagtacaagcctgtctgcaaccaggtagaatgtcatccttacctcaaccagagc
aaactgctggatttctgcaagtcaaaagacattgttctggttgcccacagtgctctggga
acccaacgacataaactatgggtggacccaaactccccagttcttttggaggacccagtt
ctttgtgccttagcaaagaaacacaaacaaaccccagccctgattgccctgcgctaccag
ctgcagcgtggggttgtggtcctggccaagagctacaatgagcagcggatcagagagaac
atccaggtttttgaattccagttgacatcagaggatatgaaagttctagatggtctaaac
agaaattatcgatatgttgtcatggattttcttatggaccatcctgattatccattttca
gatgaatattag

DBGET integrated database retrieval system