KEGG   Homo sapiens (human): 112939
Entry
112939            CDS       T01001                                 
Symbol
NACC1, BEND8, BTBD14B, BTBD30, NAC-1, NAC1, NECFM
Name
(RefSeq) nucleus accumbens associated 1
  KO
K10486  BTB/POZ domain-containing protein 14
Organism
hsa  Homo sapiens (human)
Disease
H02470  Neurodevelopmental disorder with structural brain abnormalities
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    112939 (NACC1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     112939 (NACC1)
SSDB
Motif
Pfam: BTB BEN KLHL33-like_BTB_POZ Mso1_C
Other DBs
NCBI-GeneID: 112939
NCBI-ProteinID: NP_443108
OMIM: 610672
HGNC: 20967
Ensembl: ENSG00000160877
Position
19:13116852..13141147
AA seq 527 aa
MAQTLQMEIPNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFN
NSRSAVVELPAAVQPQSFQQILSFCYTGRLSMNVGDQFLLMYTAGFLQIQEIMEKGTEFF
LKVSSPSCDSQGLHAEEAPSSEPQSPVAQTSGWPACSTPLPLVSRVKTEQQESDSVQCMP
VAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAG
QPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQI
CNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCHPKLY
DEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGI
RSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMPKVK
VLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEALQ
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggcccagacactgcagatggagatcccgaacttcggcaacagcatcctggagtgcctc
aatgaacagcggctgcagggcctgtactgtgacgtgtcagtggtggtcaagggccatgcc
ttcaaggcccaccgggccgtgcttgctgccagcagctcctacttccgggacctgttcaac
aacagccgcagcgccgtggtggagctgccggcggctgtgcagccccagtctttccagcag
atcctcagcttctgctacacgggccggctgagcatgaacgtgggcgaccagttcctgctc
atgtacacggctggcttcctgcagatccaggagatcatggagaagggcaccgagttcttc
ctcaaggtgagctccccgagctgcgactcccagggcctgcatgcggaggaggccccatcg
tcggagccccagagccccgtggcgcagacatcgggctggccagcctgtagcaccccgctg
cccctcgtgtcgcgggtgaagacggagcagcaggagtcggactccgtgcagtgcatgccc
gtggccaagcggctgtgggacagtggccagaaggaggctgggggcggcggcaatggcagc
cgcaagatggccaagttctccacgccggacctggctgccaaccggcctcaccagcccccg
ccaccccaacaggctccggtggtggcagcagcccagcccgccgtggctgcgggagcaggg
cagccagccggtggggtggcagcagcagggggtgtggtgagtgggcccagcacgtcggag
cggaccagcccaggcacctcaagcgcctacaccagcgacagccctggctcctaccacaat
gaggaggacgaggaggaggatggtggcgaggagggcatggatgagcagtaccggcagatc
tgcaacatgtacaccatgtacagcatgatgaacgtcggccagacagccgagaaggtggag
gccctcccggagcaggtagcccccgagtcccgaaatcgcatccgggttcggcaagacctg
gcgtctctcccggctgaacttatcaaccagattgggaaccgctgccaccccaagctctac
gacgagggcgacccctctgagaagctggagctggtgacaggcaccaacgtgtacatcaca
agggcgcagctgatgaactgccacgtcagcgcaggcacgcggcacaaggtcctactgcgg
cggctcctggcctccttctttgaccggaacacgctggccaacagctgcggcaccggcatc
cgctcttctaccaacgatccccgtcggaagcccctggacagccgcgtgctccacgctgtc
aagtactactgccagaacttcgcccccaacttcaaggagagcgagatgaatgccatcgcg
gccgacatgtgcaccaacgcccgccgcgtcgtgcgcaagagctggatgcccaaggtcaag
gtgctcaaggctgaggatgacgcctacaccaccttcatcagtgaaacgggcaagatcgag
ccggacatgatgggtgtggagcatggcttcgagaccgccagccacgagggcgaggcgggt
ccctcggctgaagccctgcagtaa

DBGET integrated database retrieval system