KEGG   Homo sapiens (human): 117854
Entry
117854            CDS       T01001                                 
Symbol
TRIM6, RNF89
Name
(RefSeq) tripartite motif containing 6
  KO
K11999  tripartite motif-containing protein 6/22/34
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    117854 (TRIM6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    117854 (TRIM6)
SSDB
Motif
Pfam: SPRY zf-RING_UBOX zf-B_box zf-C3HC4 zf-C3HC4_4 zf-C3HC4_2 zf-RING_5 PRY zf-RING_2 zf-C3HC4_3 FAM76 zf-Nse zf-RING_10 HisKin-conflict Fib_alpha Atg11_middle TRAF3_RING zf-UDP Borrelia_P83 zf-RING_6
Other DBs
NCBI-GeneID: 117854
NCBI-ProteinID: NP_477514
OMIM: 607564
HGNC: 16277
Ensembl: ENSG00000121236
UniProt: Q9C030
Position
11:5596111..5612952
AA seq 488 aa
MTSPVLVDIREEVTCPICLELLTEPLSIDCGHSFCQACITPNGRESVIGQEGERSCPVCQ
TSYQPGNLRPNRHLANIVRRLREVVLGPGKQLKAVLCADHGEKLQLFCQEDGKVICWLCE
RSQEHRGHHTFLVEEVAQEYQEKFQESLKKLKNEEQEAEKLTAFIREKKTSWKNQMEPER
CRIQTEFNQLRNILDRVEQRELKKLEQEEKKGLRIIEEAENDLVHQTQSLRELISDLERR
CQGSTMELLQDVSDVTERSEFWTLRKPEALPTKLRSMFRAPDLKRMLRVCRELTDVQSYW
VDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFSSGKHYWEVD
VAKKTAWILGVCSNSLGPTFSFNHFAQNHSAYSRYQPQSGYWVIGLQHNHEYRAYEDSSP
SLLLSMTVPPRRVGVFLDYEAGTVSFYNVTNHGFPIYTFSKYYFPTTLCPYFNPCNCVIP
MTLRRPSS
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgacttcaccagtactggtggacatacgagaagaggtgacctgccctatctgcctggag
ctcctaacagaacccctgagcatagactgtggccacagcttctgccaagcctgcatcaca
ccaaatggcagggaatcagtgattggtcaagaaggggaaagaagctgccctgtgtgccag
accagctaccagccagggaacctgcggcctaatcggcatctggccaacatagtgaggcgg
ctcagagaggtagtgttgggccctgggaagcagctgaaagcagttctttgtgcagaccat
ggagaaaaactgcagctcttctgtcaggaggatgggaaggtcatttgctggctttgtgag
cggtctcaggagcaccgtggtcaccacacgttcctcgtggaggaggttgcccaggagtac
caggagaagtttcaggagtctctaaagaagctgaagaacgaggagcaggaagctgagaag
ctaacagcttttatcagagagaagaaaacatcctggaagaatcagatggagcctgagaga
tgcaggatccagacagagtttaatcagctgcgaaatatcctagacagagtggagcaacgg
gagctgaaaaagctggaacaggaagagaagaaggggctacgaattatagaagaggctgag
aatgatctggtccaccagacccagtcgctgcgagagctcatctcggatctggagcgtcga
tgtcaggggtcaacaatggagctgctgcaggatgtgagtgatgtcacagaaaggagtgag
ttctggaccctgaggaagccagaagctctccctacaaagctgagaagtatgttccgagcc
ccagatctgaaaaggatgctgcgagtgtgtagagagctgacagatgtccaaagctactgg
gttgacgtgaccctgaatccacacacagctaatttaaatcttgtcctggctaaaaaccgg
agacaagtgaggtttgtgggagctaaagtatctggaccttcctgtctggaaaagcattat
gactgtagtgtcctgggctcccagcacttctcctctggtaagcattactgggaggtagat
gtggccaagaagactgcctggatcctgggggtatgcagcaattcactgggacctacattc
tctttcaaccattttgctcaaaatcacagtgcttactccaggtatcagcctcagagtgga
tactgggtgattgggttacagcataaccatgaatatagggcctatgaggattcttcccct
tccctgcttctctccatgacagtgccccctcgccgtgttggggttttcttagattatgag
gctggtactgtctccttttataatgtcacaaaccatggcttccccatctacactttctct
aaatattactttcccactactctttgtccatattttaatccttgcaactgtgtaattcct
atgaccctgcgtcgtccaagctcttga

DBGET integrated database retrieval system