KEGG   Homo sapiens (human): 119548
Entry
119548            CDS       T01001                                 
Symbol
PNLIPRP3
Name
(RefSeq) pancreatic lipase related protein 3
  KO
K14076  pancreatic lipase-related protein 3 [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
Module
hsa_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    119548 (PNLIPRP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     119548 (PNLIPRP3)
SSDB
Motif
Pfam: Lipase PLAT Abhydrolase_6 LIDHydrolase
Other DBs
NCBI-GeneID: 119548
NCBI-ProteinID: NP_001011709
HGNC: 23492
Ensembl: ENSG00000203837
Vega: OTTHUMG00000019100
Pharos: Q17RR3(Tdark)
UniProt: Q17RR3
Position
10:116427847..116477957
AA seq 467 aa
MLGIWIVAFLFFGTSRGKEVCYERLGCFKDGLPWTRTFSTELVGLPWSPEKINTRFLLYT
IHNPNAYQEISAVNSSTIQASYFGTDKITRINIAGWKTDGKWQRDMCNVLLQLEDINCIN
LDWINGSREYIHAVNNLRVVGAEVAYFIDVLMKKFEYSPSKVHLIGHSLGAHLAGEAGSR
IPGLGRITGLDPAGPFFHNTPKEVRLDPSDANFVDVIHTNAARILFELGVGTIDACGHLD
FYPNGGKHMPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSYQFYAESILNPDAFIAYP
CRSYTSFKAGNCFFCSKEGCPTMGHFADRFHFKNMKTNGSHYFLNTGSLSPFARWRHKLS
VKLSGSEVTQGTVFLRVGGAVRKTGEFAIVSGKLEPGMTYTKLIDADVNVGNITSVQFIW
KKHLFEDSQNKLGAEMVINTSGKYGYKSTFCSQDIMGPNILQNLKPC
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgcttggaatttggattgttgcattcttgttctttggcacatcaagaggaaaagaagtt
tgctatgaaaggttagggtgtttcaaagatggtttaccatggaccaggactttctcaaca
gagttggtaggtttaccctggtctccagagaagataaacactcgtttcctgctctacact
atacacaatcccaatgcctatcaggagatcagtgcggttaattcttcaactatccaagcc
tcatattttggaacagacaagatcacccgtatcaacatagctggatggaaaacagatggc
aaatggcagagagacatgtgcaatgtgttgctacagctggaagatataaattgcattaat
ttagattggatcaacggttcacgggaatacatccatgctgtaaacaatctccgtgttgtt
ggtgctgaggtggcttattttattgatgttctcatgaaaaaatttgaatattccccttct
aaagtgcacttgattggccacagcttgggagcacacctggctggggaagctgggtcaagg
ataccaggccttggaagaataactgggttggacccagctgggccatttttccacaacact
ccaaaggaagtcaggctagacccctcggatgccaactttgttgacgttattcatacaaat
gcagctcgcatcctctttgagcttggtgttggaaccattgatgcttgtggtcatcttgac
ttttacccaaatggagggaagcacatgccaggatgtgaagacttaattacacctttactg
aaatttaacttcaatgcttacaaaaaagaaatggcttccttctttgactgtaaccatgcc
cgaagttatcaattttatgctgaaagcattcttaatcctgatgcatttattgcttatcct
tgtagatcctacacatcttttaaagcaggaaattgcttcttttgttccaaagaaggttgc
ccaacaatgggtcattttgctgatagatttcacttcaaaaatatgaagactaatggatca
cattattttttaaacacagggtccctttccccatttgcccgttggaggcacaaattgtct
gttaaactcagtggaagcgaagtcactcaaggaactgtctttcttcgtgtaggcggggca
gttaggaaaactggggagtttgccattgtcagtggaaaacttgagccaggcatgacttac
acaaaattaatcgatgcagatgttaacgttggaaacattacaagtgttcagttcatctgg
aaaaaacatttgtttgaagattctcagaataagttgggagcagaaatggtgataaataca
tctgggaaatatggatataaatctaccttctgtagccaagacattatgggacctaatatt
ctccagaacctgaaaccatgctaa

DBGET integrated database retrieval system