KEGG   Homo sapiens (human): 121340
Entry
121340            CDS       T01001                                 

Gene name
SP7, OI11, OI12, OSX, osterix
Definition
(RefSeq) Sp7 transcription factor
  KO
K09197  transcription factor Sp7
Organism
hsa  Homo sapiens (human)
Disease
H00506  Osteogenesis imperfecta
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    121340 (SP7)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    121340 (SP7)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-LYAR zf-C2H2_8
Other DBs
NCBI-GeneID: 121340
NCBI-ProteinID: NP_001166938
OMIM: 606633
HGNC: 17321
Ensembl: ENSG00000170374
Vega: OTTHUMG00000170031
Pharos: Q8TDD2(Tbio)
UniProt: Q8TDD2
Position
12q13.13
AA seq 431 aa
MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSASKTM
GDAYPAPFTSTNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSD
CLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQG
TLPTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSGQL
EGSGGAKPPRGASTGGSGGYGGSGAGRSSCDCPNCQELERLGAAAAGLRKKPIHSCHIPG
CGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTREKKFTCLLCS
KRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSTGEEEASQTPRPSASPATPEKAPG
GSPEQSNLLEI
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggcgtcctccctgcttgaggaggaagttcactatggctccagtcccctggccatgctg
acggcagcgtgcagcaaatttggtggctctagccctctgcgggactcaacaactctgggc
aaagcaggcacaaagaagccgtactctgtgggcagtgacctttcagcctccaaaaccatg
ggggatgcttatccagccccctttacaagcactaatgggctcctttcacctgcaggcagt
cctccagcacccacctcaggctatgctaatgattaccctcccttttcccactcattccct
gggcccacaggcacccaggaccctgggctactagtgcccaaggggcacagctcttctgac
tgtctgcccagtgtctacacctctctggacatgacacacccctatggctcctggtacaag
gcaggcatccatgcaggcatttcaccaggcccaggcaacactcctactccatggtgggat
atgcaccctggaggcaactggctaggtggtgggcagggccagggtgatgggctgcaaggg
acactgcccacaggtccagctcagcctccactgaacccccagctgcccacctacccatct
gactttgctccccttaatccagccccctacccagctccccacctcttgcaaccagggccc
cagcatgtcttgccccaagatgtctataaacccaaggcagtgggaaatagtgggcagcta
gaagggagtggtggagccaaacccccacggggtgcaagcactgggggtagtggtggatat
gggggcagtggggcagggcgctcctcctgcgactgccctaattgccaggagctagagcgg
ctgggagcagcagcggctgggctgcggaagaagcccatccacagctgccacatccctggc
tgcggcaaggtgtatggcaaggcttcgcacctgaaggcccacttgcgctggcacacaggc
gagaggcccttcgtctgcaactggctcttctgcggcaagaggttcactcgttcggatgag
ctggagcgtcatgtgcgcactcacacccgggagaagaagttcacctgcctgctctgctcc
aagcgctttacccgaagcgaccacctgagcaaacaccagcgcacccatggagaaccaggc
ccgggtccccctcccagtggccccaaggagctgggggagggccgcagcacgggggaagag
gaggccagtcagacgccccgaccttctgcctcgccagcaaccccagagaaagcccctgga
ggcagccctgagcagagcaacttgctggagatctga

DBGET integrated database retrieval system