KEGG   Homo sapiens (human): 121536Help
Entry
121536            CDS       T01001                                 

Gene name
AEBP2
Definition
(RefSeq) AE binding protein 2
  KO
K17452  zinc finger protein AEBP2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    121536 (AEBP2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    121536 (AEBP2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    121536 (AEBP2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC2-EZH2 complex
     121536 (AEBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 DUF4764
Motif
Other DBs
NCBI-GeneID: 121536
NCBI-ProteinID: NP_001107648
OMIM: 617934
HGNC: 24051
Ensembl: ENSG00000139154
Vega: OTTHUMG00000168906
Pharos: Q6ZN18(Tbio)
UniProt: Q6ZN18
Structure
PDB: 

Position
12p12.3
AA seq 517 aa AA seqDB search
MAAAITDMADLEELSRLSPLPPGSPGSAARGRAEPPEEEEEEEEEEEEAEAEAVAALLLN
GGSGGGGGGGGGGVGGGEAETMSEPSPESASQAGEDEDEEEDDEEEEDESSSSGGGEEES
SAESLVGSSGGSSSDETRSLSPGAASSSSGDGDGKEGLEEPKGPRGSQGGGGGGSSSSSV
VSSGGDEGYGTGGGGSSATSGGRRGSLEMSSDGEPLSRMDSEDSISSTIMDVDSTISSGR
STPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWK
GCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSK
VSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIE
SLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKL
PKDTALLLDPNIYRTMPQKRLKRTLIRKVFNLYLSKQ
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgctatcaccgacatggccgacctggaggagctctcccgcctgagccctctg
ccccccggcagcccgggttcggcggcgcggggccgggctgagccccccgaggaggaggag
gaagaggaggaggaggaagaggaggcggaggccgaggcggtggcggcgctgctgctgaac
ggcggcagcggtgggggcggcggaggcggcggcggaggagtggggggcggcgaggcagag
acgatgtcggagccgagccccgagagcgccagccaggccggggaggacgaagacgaggag
gaggacgacgaggaggaggaagatgagagcagcagcagcggcgggggtgaggaggagagt
agcgccgagagcctggtgggcagcagcggcgggagcagcagcgacgagacccgctcgttg
agccccggcgccgccagcagcagcagcggggatggggacggcaaggagggcctggaggag
cccaagggaccgcggggcagccagggcggcggcgggggcggcagcagtagcagcagcgta
gtctccagcggcggcgacgagggctacgggactgggggaggcggaagcagcgcgacctcc
gggggccggcggggcagcttggagatgtcgtcggatggggaacccctgagccgcatggac
tcggaggacagcataagcagtactataatggatgtagacagcacaatttccagtgggcgt
tcaactccagcaatgatgaatggacaaggaagcactacttcttcaagcaaaaatattgcc
tataattgttgttgggaccagtgccaggcttgcttcaactctagcccagatctggcagat
cacatccgttccatacatgtagatggtcagcgaggaggggtatttgtttgcttatggaaa
ggttgtaaagtatataacactccatctaccagtcaaagttggttacaaaggcatatgctg
acacacagtggagacaaacctttcaagtgtgttgttggtggctgcaatgccagctttgct
tctcagggagggctagctcgtcatgtacccacacacttcagtcagcagaactcctcaaaa
gtttctagccagccaaaggccaaagaagaatctccttctaaagctggaatgaacaaaagg
aggaaattaaagaacaaaagacgacgctcattaccacggccacatgatttcttcgatgca
caaacactggatgcgataagacatcgagccatatgctttaacctctcagctcatatagaa
agtttagggaagggacacagtgttgtttttcatagtactgtaatagctaagagaaaagaa
gattctgggaagatcaaacttttgcttcattggatgcctgaagacattctgcctgatgtg
tgggtgaatgaaagtgaacgacatcagttaaaaactaaagtagttcatttatcaaagcta
cccaaagatactgccttgcttttggacccaaacatatacagaacaatgccgcagaagagg
ttgaagagaactctgataagaaaagtgttcaatttgtatttaagcaaacagtga

DBGET integrated database retrieval system