KEGG   Homo sapiens (human): 124056Help
Entry
124056            CDS       T01001                                 

Gene name
NOXO1, P41NOX, P41NOXA, P41NOXB, P41NOXC, SH3PXD5, SNX28
Definition
(RefSeq) NADPH oxidase organizer 1
  KO
K17934  NADPH oxidase organizer 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    124056 (NOXO1)
Membrane trafficking [BR:hsa04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    124056 (NOXO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_1 SH3_9 SH3_2 PX
Motif
Other DBs
NCBI-GeneID: 124056
NCBI-ProteinID: NP_751908
OMIM: 611256
HGNC: 19404
Ensembl: ENSG00000196408
Vega: OTTHUMG00000128707
Pharos: Q8NFA2(Tbio)
UniProt: Q8NFA2 A8K832
Structure
PDB: 

Position
16p13.3
AA seq 376 aa AA seqDB search
MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKKTLKETFPVEA
GLLRRSDRVLPKLLGQASLDAPLLGRVGRTSRGLARLQLLETYSRRLLATAERVARSPTI
TGFFAPQPLDLEPALPPGSRVILPTPEEQPLSRAAGRLSIHSLEAQSLRCLQPFCTQDTR
DRPFQAQAQESLDVLLRHPSGWWLVENEDRQTAWFPAPYLEEAAPGQGREGGPSLGSSGP
QFCASRAYESSRADELSVPAGARVRVLETSDRGWWLCRYGDRAGLLPAVLLRPEGLGALL
SGTGFRGGDDPAGEARGFPEPSQATAPPPTVPTRPSPGAIQSRCCTVTRRALERRPRRQG
RPRGCVDSVPHPTTEQ
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcccccgatacccagtttcagtgcaaggggcagccctggtgcagatcaagagg
ctccaaacgtttgccttctctgtgcgctggtcagacggcagcgacaccttcgtgcgcagg
agttgggacgaattcaggcagctcaagaagaccctcaaggagaccttcccggtggaggcg
ggcctgctgcggagatctgaccgcgttctcccaaagcttctcggtcaggccagcctggat
gcaccactgttgggacgcgtggggcgcacgagccgcggcctggcgcgcctgcagctgttg
gaaacctattctcggaggctgctggcgactgcagagcgcgtggcacggagcccgacgatc
actggcttcttcgcaccgcaacccctggacctggagcccgcgctgccacccggcagccgg
gtgatcctgcccaccccagaggagcagcctctttctcgcgctgcgggccgcctctccatc
cacagtctggaggctcagagcctgcgctgcctgcagcccttctgtacccaggacacgcgg
gataggccttttcaggcgcaggcccaggagagcctggacgtgctgctgcggcacccctca
ggctggtggctggtggagaacgaagaccggcagaccgcctggtttccagcgccctacctg
gaggaggcggccccgggccaaggccgggagggaggcccgtccctagggagcagcggtccc
cagttctgtgcttcccgcgcctacgagagcagccgcgcagatgagctgtccgtgcccgcg
ggggcgcgcgtgcgcgtgttggaaacgtcagaccgcggctggtggctatgcaggtacggc
gaccgggcgggcctactccccgcggtgctgctgcggccggaagggctgggcgctctcctg
agcgggacggggttccgtggaggagacgacccggcgggtgaggcccggggcttccctgaa
ccctcccaggccaccgcccctccccccaccgtgcccacccgaccttcgccgggcgccatc
cagagccgctgctgcaccgtcacacgcagggccctggagcggcgcccacggcgccagggc
cgccctcgagggtgcgtggactctgtgccgcaccccacgacggagcagtga

DBGET integrated database retrieval system