KEGG   Homo sapiens (human): 126069
Entry
126069            CDS       T01001                                 

Gene name
ZNF491
Definition
(RefSeq) zinc finger protein 491
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 zf-C2H2_jaz zf-C2H2_6 zf-met DUF3268 Zn-ribbon_8 zf-trcl XPA_N
Other DBs
NCBI-GeneID: 126069
NCBI-ProteinID: NP_689569
HGNC: 23706
Ensembl: ENSG00000177599
Vega: OTTHUMG00000156529
Pharos: Q8N8L2(Tdark)
UniProt: Q8N8L2
Position
19p13.2
AA seq 437 aa
MGERLFESAEGSQCGETFTQVPEDMLNKKTLPGVKSCESGTCGEIFMGYSSFNRNIRTDT
GHQPHKCQKFLEKPYKHKQRRKALSHSHCFRTHERPHTREKPFDCKECEKSFISPASIRR
YMVTHSGDGPYKCKFCGKALDCLSLYLTHERTHTGEKRYECKQCGKAFSWHSSVRIHERT
HTGEKPYECKECGKSFNFSSSFRRHERTHTGEKPYKCKECGKAFNCPSSFHRHERTHTGE
KPYECKLYGKALSRLISFRRHMRMHTGERPHKCKICGKAFYSPSSFQRHERSHTGEKPYK
CKQCGKAFTCSTSFQYHERTHTGEKPDGCKQCGKAFRSAKYIRIHGRTHTGEKPYECKQC
GKAFHCVSSFHRHERTHAGEKPYECKHCGKAFTCSIYIRIHERIHTGEKPYQCKECGKAF
IRSSYCRKHERTHTINI
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgggagagagactctttgagagtgcagaaggtagtcagtgtggagaaactttcacccag
gttccggaagacatgctgaacaagaaaactcttcctggagtaaaatcatgtgaaagtggt
acatgtggagaaatcttcatgggatattcatcctttaataggaacatcagaactgacact
ggacaccaaccacataagtgtcagaaatttttagagaagccatataaacataaacaacgt
aggaaagccttgagccatagccactgctttcgaacacatgaaaggcctcacactagagag
aaaccttttgattgtaaggaatgtgaaaaatctttcatttctcctgcaagcattcgaaga
tatatggtaacgcacagtggagatggaccttataaatgtaagttttgtgggaaagccttg
gattgtctcagtttataccttacccatgaacgaactcacactggagagaaacgatatgaa
tgtaaacaatgtggtaaagccttcagttggcacagttctgttcgaatccatgaaagaact
cacactggggagaagccatatgaatgtaaggagtgtgggaaatcattcaatttttccagt
tcctttcgcagacatgaaaggacacacacaggagagaagccgtacaaatgtaaggaatgt
gggaaagccttcaattgtcccagttcttttcacaggcatgaaaggactcacacaggagaa
aaaccctatgaatgtaaactatatgggaaagcattatctcgccttataagctttcgaaga
cacatgagaatgcacactggagagaggcctcataaatgtaagatatgtgggaaagccttt
tactctcccagttcatttcaaaggcatgaaagaagtcacactggagagaaaccctacaaa
tgcaagcaatgtgggaaagccttcacttgttccacttcgtttcaatatcatgaaaggact
cacactggagagaaacccgatgggtgtaagcaatgtgggaaagccttcagatctgccaag
tacattcgaatacatggaaggactcacactggtgagaaaccctatgaatgtaagcaatgt
gggaaagcatttcattgtgtcagctcctttcatagacatgaaaggactcacgctggagaa
aaaccttatgaatgtaagcattgtgggaaagccttcacttgttccatatatattagaata
catgaaagaattcacactggagagaaaccttaccaatgtaaggaatgtgggaaagccttc
attcgttccagttactgtcgaaaacatgaaagaactcacactattaatatatga

DBGET integrated database retrieval system