KEGG   Homo sapiens (human): 1263Help
Entry
1263              CDS       T01001                                 

Gene name
PLK3, CNK, FNK, PLK-3, PRK
Definition
(RefSeq) polo like kinase 3
  KO
K08862  polo-like kinase 3 [EC:2.7.11.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    1263 (PLK3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    1263 (PLK3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    1263 (PLK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1263 (PLK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1263 (PLK3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    1263 (PLK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     1263 (PLK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   1263 (PLK3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Polo kinases
    1263 (PLK3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    1263 (PLK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Kinase-like Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 1263
NCBI-ProteinID: NP_004064
OMIM: 602913
HGNC: 2154
Ensembl: ENSG00000173846
Vega: OTTHUMG00000008491
Pharos: Q9H4B4(Tchem)
UniProt: Q9H4B4
Structure
PDB: 

Position
1p34.1
AA seq 646 aa AA seqDB search
MEPAAGFLSPRPFQRAAAAPAPPAGPGPPPSALRGPELEMLAGLPTSDPGRLITDPRSGR
TYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHR
HIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRG
ILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPE
ADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPR
DRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPARSLFAKVTKSLFGRKKKSKN
HAQERDEVSGLVSGLMRTSVGHQDARPEAPAASGPAPVSLVETAPEDSSPRGTLASSGDG
FEEGLTVATVVESALCALRNCIAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQL
SSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYME
QHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEP
LLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgccgccggtttcctgtctccgcgccccttccagcgtgcggccgccgcgccc
gctcccccggccgggcccgggccgcctccgagtgccttgcgcggacctgagctggagatg
ctggccgggctaccgacgtcagaccccgggcgcctcatcacggacccgcgcagcggccgc
acctacctcaaaggccgcttgttgggcaaggggggcttcgcccgctgctacgaggccact
gacacagagactggcagcgcctacgctgtcaaagtcatcccgcagagccgcgtcgccaag
ccgcatcagcgcgagaagatcctaaatgagattgagctgcaccgagacctgcagcaccgc
cacatcgtgcgtttttcgcaccactttgaggacgctgacaacatctacattttcttggag
ctctgcagccgaaagtccctggcccacatctggaaggcccggcacaccctgttggagcca
gaagtgcgctactacctgcggcagatcctttctggcctcaagtacttgcaccagcgcggc
atcttgcaccgggacctcaagttgggaaattttttcatcactgagaacatggaactgaag
gtgggggattttgggctggcagcccggttggagcctccggagcagaggaagaagaccatc
tgtggcacccccaactatgtggctccagaagtgctgctgagacagggccacggccctgag
gcggatgtatggtcactgggctgtgtcatgtacacgctgctctgcgggagccctcccttt
gagacggctgacctgaaggagacgtaccgctgcatcaagcaggttcactacacgctgcct
gccagcctctcactgcctgcccggcagctcctggccgccatccttcgggcctcaccccga
gaccgcccctctattgaccagatcctgcgccatgacttctttaccaagggctacaccccc
gatcgactccctatcagcagctgcgtgacagtcccagacctgacaccccccaacccagct
aggagtctgtttgccaaagttaccaagagcctctttggcagaaagaagaagagtaagaat
catgcccaggagagggatgaggtctccggtttggtgagcggcctcatgcgcacatccgtt
ggccatcaggatgccaggccagaggctccagcagcttctggcccagcccctgtcagcctg
gtagagacagcacctgaagacagctcaccccgtgggacactggcaagcagtggagatgga
tttgaagaaggtctgactgtggccacagtagtggagtcagccctttgtgctctgagaaat
tgtatagccttcatgcccccagcggaacagaacccggcccccctggcccagccagagcct
ctggtgtgggtcagcaagtgggttgactactccaataagttcggctttgggtatcaactg
tccagccgccgtgtggctgtgctcttcaacgatggcacacatatggccctgtcggccaac
agaaagactgtgcactacaatcccaccagcacaaagcacttctccttctccgtgggtgct
gtgccccgggccctgcagcctcagctgggtatcctgcggtacttcgcctcctacatggag
cagcacctcatgaagggtggagatctgcccagtgtggaagaggtagaggtacctgctccg
cccttgctgctgcagtgggtcaagacggatcaggctctcctcatgctgtttagtgatggc
actgtccaggtgaacttctacggggaccacaccaagctgattctcagtggctgggagccc
ctccttgtgacttttgtggcccgaaatcgtagtgcttgtacttacctcgcttcccacctt
cggcagctgggctgctctccagacctgcggcagcgactccgctatgctctgcgcctgctc
cgggaccgcagcccagcctag

DBGET integrated database retrieval system