KEGG   Homo sapiens (human): 1271Help
Entry
1271              CDS       T01001                                 

Gene name
CNTFR
Definition
(RefSeq) ciliary neurotrophic factor receptor
  KO
K05059  ciliary neurotrophic factor receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
Drug target
Dapiclermin: D03647
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    1271 (CNTFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1271 (CNTFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    1271 (CNTFR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    1271 (CNTFR)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL6/12 receptor family
   1271 (CNTFR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  1271 (CNTFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Ig_3 Ig_5
Motif
Other DBs
NCBI-GeneID: 1271
NCBI-ProteinID: NP_001193940
OMIM: 118946
HGNC: 2170
Ensembl: ENSG00000122756
Vega: OTTHUMG00000019821
Pharos: P26992(Tbio)
UniProt: P26992
Structure
PDB: 

Position
9p13.3
AA seq 372 aa AA seqDB search
MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLVSVPITLAL
AAAAATASSLLI
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcctgtcccgtgggcctgctgtgctgtgcttgccgccgccgccgcagttgtc
tacgcccagagacacagtccacaggaggcaccccatgtgcagtacgagcgcctgggctct
gacgtgacactgccatgtgggacagcaaactgggatgctgcggtgacgtggcgggtaaat
gggacagacctggcccctgacctgctcaacggctctcagctggtgctccatggcctggaa
ctgggccacagtggcctctacgcctgcttccaccgtgactcctggcacctgcgccaccaa
gtcctgctgcatgtgggcttgccgccgcgggagcctgtgctcagctgccgctccaacact
taccccaagggcttctactgcagctggcatctgcccacccccacctacattcccaacacc
ttcaatgtgactgtgctgcatggctccaaaattatggtctgtgagaaggacccagccctc
aagaaccgctgccacattcgctacatgcacctgttctccaccatcaagtacaaggtctcc
ataagtgtcagcaatgccctgggccacaatgccacagctatcacctttgacgagttcacc
attgtgaagcctgatcctccagaaaatgtggtagcccggccagtgcccagcaaccctcgc
cggctggaggtgacgtggcagaccccctcgacctggcctgaccctgagtcttttcctctc
aagttctttctgcgctaccgacccctcatcctggaccagtggcagcatgtggagctgtcc
gacggcacagcacacaccatcacagatgcctacgccgggaaggagtacattatccaggtg
gcagccaaggacaatgagattgggacatggagtgactggagcgtagccgcccacgctacg
ccctggactgaggaaccgcgacacctcaccacggaggcccaggctgcggagaccacgacc
agcaccaccagctccctggcacccccacctaccacgaagatctgtgaccctggggagctg
ggcagcggcgggggaccctcggcacccttcttggtcagcgtccccatcactctggccctg
gctgccgctgccgccactgccagcagtctcttgatctga

DBGET integrated database retrieval system