KEGG   Homo sapiens (human): 1272Help
Entry
1272              CDS       T01001                                 

Gene name
CNTN1, F3, GP135, MYPCN
Definition
(RefSeq) contactin 1
  KO
K06759  contactin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1272 (CNTN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    1272 (CNTN1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    1272 (CNTN1)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  Contactins
   1272 (CNTN1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  1272 (CNTN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 V-set Ig_6 Ig_5 Ig_4 Pur_ac_phosph_N C2-set_2 Big_3_4 Interfer-bind
Motif
Other DBs
NCBI-GeneID: 1272
NCBI-ProteinID: NP_001834
OMIM: 600016
HGNC: 2171
Ensembl: ENSG00000018236
Vega: OTTHUMG00000169362
Pharos: Q12860(Tbio)
UniProt: Q12860 A0A024R104
Structure
PDB: 

Position
12q12
AA seq 1018 aa AA seqDB search
MKMWLLVSHLVIISITTCLAEFTWYRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGK
VSLNCRARASPFPVYKWRMNNGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNY
GMVRSTEATLSFGYLDPFPPEERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVF
ITMDKRRFVSQTNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPY
PADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNI
QLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCVATGKPIP
TIRWLKNGYAYHKGELRLYDVTFENAGMYQCIAENTYGAIYANAELKILALAPTFEMNPM
KKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRNDGG
IYTCFAENNRGKANSTGTLVITDPTRIILAPINADITVGENATMQCAASFDPALDLTFVW
SFNGYVIDFNKENIHYQRNFMLDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVV
RGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKTDPPIIE
GNMEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRIKTDGAAPNVAPSDVGGGGGRN
RELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHKDETMSPSTAF
QVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKIVESY
QIRYWAAHDKEEAANRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPPSDMIEAFT
KKAPPSQPPRIISSVRSGSRYIITWDHVVALSNESTVTGYKVLYRPDGQHDGKLYSTHKH
SIEVPIPRDGEYVVEVRAHSDGGDGVVSQVKISGAPTLSPSLLGLLLPAFGILVYLEF
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgtggttgctggtcagtcatcttgtgataatatctattactacctgtttagca
gagtttacatggtatagaagatatggtcatggagtttctgaggaagacaaaggatttgga
ccaatttttgaagagcagccaatcaataccatttatccagaggaatcactggaaggaaaa
gtctcactcaactgtagggcacgagccagccctttcccggtttacaaatggagaatgaat
aatggggacgttgatctcacaagtgatcgatacagtatggtaggaggaaaccttgttatc
aacaaccctgacaaacagaaagatgctggaatatactactgtttagcatctaataactac
gggatggtcagaagcactgaagcaaccctgagctttggatatcttgatcctttcccacct
gaggaacgtcctgaggtcagagtaaaagaagggaaaggaatggtgcttctctgtgacccc
ccataccattttccagatgatcttagctatcgctggcttctaaatgaatttcctgtattt
atcacaatggataaacggcgatttgtgtctcagacaaatggcaatctctacattgcaaat
gttgaggcttccgacaaaggcaattattcctgctttgtttccagtccttctattacaaag
agcgtgttcagcaaattcatcccactcattccaatacctgaacgaacaacaaaaccatat
cctgctgatattgtagttcagttcaaggatgtatatgcattgatgggccaaaatgtgacc
ttagaatgttttgcacttggaaatcctgttccggatatccgatggcggaaggttctagaa
ccaatgccaagcactgctgagattagcacctctggggctgttcttaagatcttcaatatt
cagctagaagatgaaggcatctatgaatgtgaggctgagaacattagaggaaaggataaa
catcaagcaagaatttatgttcaagcattccctgagtgggtagaacacatcaatgacaca
gaggtggacataggcagtgatctctactggccttgtgtggccacaggaaagcccatccct
acaatccgatggttgaaaaatggatatgcgtatcataaaggggaattaagactgtatgat
gtgacttttgaaaatgccggaatgtatcagtgcatagctgaaaacacatatggagccatt
tatgcaaatgctgagttgaagatcttggcgttggctccaacttttgaaatgaatcctatg
aagaaaaagatcctggctgctaaaggtggaagggtgataattgaatgcaaacctaaagct
gcaccgaaaccaaagttttcatggagtaaagggacagagtggcttgtcaatagcagcaga
atactcatttgggaagatggtagcttggaaatcaacaacattacaaggaatgatggaggt
atctatacatgctttgcagaaaataacagagggaaagctaatagcactggaacccttgtt
atcacagatcctacgcgaattatattggccccaattaatgccgatatcacagttggagaa
aacgccaccatgcagtgtgctgcgtcctttgatcctgccttggatctcacatttgtttgg
tccttcaatggctatgtgatcgattttaacaaagagaatattcactaccagaggaatttt
atgctggattccaatggggaattactaatccgaaatgcgcagctgaaacatgctggaaga
tacacatgcactgcccagacaattgtggacaattcttcagcttcagctgaccttgtagtg
agaggccctccaggccctccaggtggtctgagaatagaagacattagagccacttctgtg
gcacttacttggagccgtggttcagacaatcatagtcctatttctaaatacactatccag
accaagactattctttcagatgactggaaagatgcaaagacagatcccccaattattgaa
ggaaatatggaggcagcaagagcagtggacttaatcccatggatggagtatgaattccgc
gtggtagcaaccaatacactgggtagaggagagcccagtataccatctaacagaattaaa
acagacggtgctgcaccaaatgtggctccttcagatgtaggaggtggaggtggaagaaac
agagagctgaccataacatgggcgcctttgtcaagagaataccactatggcaacaatttt
ggttacatagtggcatttaagccatttgatggagaagaatggaaaaaagtcacagttact
aatcctgatactggccgatatgtccataaagatgaaaccatgagcccttccactgcattt
caagttaaagtcaaggccttcaacaacaaaggagatggaccttacagcctagtagcagtc
attaattcagcacaagacgctcccagtgaagccccaacagaagtaggtgtaaaagtctta
tcatcttctgagatatctgttcattgggaacatgttttagaaaaaatagtggaaagctat
cagattcggtattgggctgcccatgacaaagaagaagctgcaaacagagttcaagtcacc
agccaagagtactcggccaggctcgagaaccttctgccagacacccagtattttatagaa
gtcggggcctgcaatagtgcagggtgtggacctccaagtgacatgattgaggctttcacc
aagaaagcacctcctagccagcctccaaggatcatcagttcagtaaggtctggttcacgc
tatataatcacctgggatcatgtcgttgcactatcaaatgaatctacagtgacgggatat
aaggtactctacagacctgatggccagcatgatggcaagctgtattcaactcacaaacac
tccatagaagtcccaatccccagagatggagaatacgttgtggaggttcgcgcgcacagt
gatggaggagatggagtggtgtctcaagtcaaaatttcaggtgcacccaccctatcccca
agtcttctcggcttactgctgcctgcctttggcatccttgtctacttggaattctga

DBGET integrated database retrieval system