KEGG   Homo sapiens (human): 1285Help
Entry
1285              CDS       T01001                                 

Gene name
COL4A3
Definition
(RefSeq) collagen type IV alpha 3 chain
  KO
K06237  collagen, type IV, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04974  Protein digestion and absorption
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Disease
H00581  Alport syndrome
H00582  Benign familial hematuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    1285 (COL4A3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    1285 (COL4A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    1285 (COL4A3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    1285 (COL4A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    1285 (COL4A3)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    1285 (COL4A3)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    1285 (COL4A3)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    1285 (COL4A3)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    1285 (COL4A3)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    1285 (COL4A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1285 (COL4A3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1285 (COL4A3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   1285 (COL4A3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   1285 (COL4A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C4
Motif
Other DBs
NCBI-GeneID: 1285
NCBI-ProteinID: NP_000082
OMIM: 120070
HGNC: 2204
Ensembl: ENSG00000169031
Vega: OTTHUMG00000149891
Pharos: Q01955(Tbio)
UniProt: Q01955
Structure
PDB: 

Position
2q36.3
AA seq 1670 aa AA seqDB search
MSARTAPRPQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPGSP
GQKGFTGPEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPGNTGPYGLV
GVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGDPGLPGAPG
PQGLPGPPGFPGPVGPPGPPGFFGFPGAMGPRGPKGHMGERVIGHKGERGVKGLTGPPGP
PGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSEKGAPGDPGLQGKPG
KDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPG
PPGPRGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSP
GCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCP
YIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKGEK
GETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGD
PGSPGSPGPAGPAGPPGYGPQGEPGLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGP
PGPPGHPGPQGPPGIPGSLGKCGDPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSL
GCPGKMGEPGLPGKPGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPG
TPGNEGLDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGD
PGIPGLDRSGFPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAI
GPPGPPGNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLK
GFAGNPGEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRGIPGSMGNM
GMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGDMG
KKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRGPPG
LPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKGDRGAPGFP
GLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPG
SHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLPGPRGDPGFQGFPGVKGE
KGNPGFLGSIGPPGPIGPKGPPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGP
PGNLGPCGPRGKPGKDGKPGTPGPAGEKGNKGSKGEPGPAGSDGLPGLKGKRGDSGSPAT
WTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTM
PFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAV
HSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRG
TCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH
NT seq 5013 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccggaccgcccccaggccgcaggtgctcctgctgccgctcctgctggtgctc
ctggcggcggcgcccgcagccagcaagggttgtgtctgtaaagacaaaggccagtgcttc
tgtgacggggccaaaggggagaagggggagaagggctttcctggaccccccggttctcct
ggccagaaaggattcacaggtcctgaaggcttgcctggaccgcagggacccaagggcttt
ccaggacttccaggactcacgggttccaaaggtgtaaggggaataagtggattgccagga
ttttctggttctcctggacttccaggcaccccaggcaataccgggccttacggacttgtc
ggtgtaccaggatgcagtggttctaagggtgagcaggggtttccaggactcccagggaca
ctgggctacccagggatcccgggtgctgctggtttgaaaggacaaaagggtgctcctgct
aaagaagaagatatagaacttgatgcaaaaggcgaccccgggttgccaggggctccagga
ccccagggtttgccaggccctccaggttttcctgggcctgttggcccacctggtcctccg
ggattctttggctttccaggagccatgggacctagaggacctaagggtcacatgggtgaa
agagtgataggacataaaggagagcggggtgtgaaagggttaacaggacccccgggacca
ccaggaacagttattgtgaccctaactggcccagataacagaacggacctcaagggggaa
aagggagacaagggagcaatgggcgagcctggacctcctggaccctcaggactgcctgga
gaatcatatggatctgaaaagggtgctcctggagaccctggcctgcagggaaaacccgga
aaagatggtgttcctggcttccctggaagtgagggagtcaagggcaacaggggtttccct
gggttaatgggtgaagatggcattaagggacagaaaggggacattggccctccaggattt
cgtggtccaacagaatattatgacacataccaggaaaagggagatgaaggcactccaggc
ccaccagggcccagaggagctcgtggcccacaaggtcccagtggtccccccggagttcct
ggaagtcctggatcatcaaggcctggcctcagaggagcccctggatggccaggcctgaaa
ggaagtaaaggggaacgaggccgcccaggaaaggatgccatggggactcctgggtcccca
ggttgtgctggttcaccaggtcttccaggatcaccgggacctccaggaccgccaggtgac
atcgtttttcgcaagggtccacctggagatcacggactgccaggctatctagggtctcca
ggaatcccaggagttgatgggcccaaaggagaaccaggcctcctgtgtacacagtgccct
tatatcccagggcctcccggtctcccaggattgccagggttacatggtgtaaaaggaatc
ccaggaagacaaggcgcagctggcttgaaaggaagcccagggtccccaggaaatacaggt
cttccaggatttccaggtttcccaggtgcccagggtgacccaggacttaaaggagaaaaa
ggtgaaacacttcagcctgaggggcaagtgggtgtcccaggtgacccggggctcagaggc
caacctgggagaaagggcttggatggaattcctggaactccgggagtgaaaggattacca
ggacctaaaggcgaactggctctgagtggtgagaaaggggaccaaggtcctccaggggat
cctggctcccctgggtccccaggacctgcaggaccagctggaccacctggctacggaccc
caaggagaacctggtctccagggcacgcaaggagttcctggagcccccggaccacccgga
gaagccggccctaggggagagctcagtgtttcaacaccagttccaggcccaccaggacct
ccagggccccctggccatcctggcccccaaggtccacctggtatccctggatccctgggg
aaatgtggagatcctggtcttccagggcctgatggtgaaccaggaattccaggaattgga
tttcctgggcctcctggacctaagggagaccaaggttttccaggtacaaaaggatcactg
ggttgtcctggaaaaatgggagagcctgggttacctggaaagccaggcctcccaggagcc
aagggagaaccagcagtagccatgcctggaggaccaggaacaccaggttttccaggagaa
agaggcaattctggggaacatggagaaattggactccctggacttccaggtctccctgga
actccaggaaatgaagggcttgatggaccacgaggagatccagggcagcctggaccacct
ggagaacaaggacccccaggaaggtgcatagagggtcccaggggagcccaaggacttcca
ggcttaaatggattgaaagggcaacaaggcagaagaggtaaaacggggccaaagggagac
ccaggaattccaggcttggatagatcaggatttcctggagaaactggatcaccaggaatt
ccaggtcatcaaggtgaaatgggaccactgggtcaaagaggatatccaggaaatccggga
attttagggccaccaggtgaagatggagtgattgggatgatgggctttcctggagccatt
ggccctccagggccccctgggaacccaggcacaccagggcagagggggagccctggaatt
ccaggagtaaagggccagagaggaaccccaggagccaagggggaacaaggagataaagga
aatcccgggccttcagagatatcccacgtaataggggacaaaggagaaccaggtctcaaa
ggattcgcaggaaatccaggtgagaaaggaaacagaggcgttccagggatgccaggttta
aagggcctcaaaggactacccggaccagcaggaccaccaggccccagaggagatttgggc
agcactgggaatcctggagaaccaggactgcgtggtataccaggaagcatggggaacatg
ggcatgccaggttctaaaggaaaaaggggaactttgggattcccaggtcgagcaggaaga
ccaggcctcccaggtattcatggtctccagggagataagggagagccaggttattcagaa
ggtacaaggccaggaccaccgggaccaacgggggatccaggactgccgggtgatatggga
aagaaaggagaaatggggcaacctggcccacctggacatttggggcctgctggacctgag
ggagcccctggaagtcctggaagtcctggcctcccaggaaagccaggtcctcatggtgat
ttgggttttaaaggaatcaaaggcctcctgggccctccaggaatcagaggccctccaggt
cttccaggatttccaggatctcctggaccaatgggtataagaggtgaccaaggacgtgat
ggaattcctggtccagccggagaaaagggagaaacgggtttattgagggcccctccaggc
ccaagagggaaccctggtgctcaaggagccaaaggagacaggggagccccaggttttcct
ggcctcccgggcagaaaaggggccatgggagatgctggacctcgaggacccacaggcata
gaaggattcccagggccaccaggtctgcccggtgcaattatccctggccagacaggaaat
cgtggtccaccaggctcaagaggaagcccaggtgcgcctggtccccctggacctccaggg
agtcatgtaataggcataaaaggagacaaagggtctatgggccaccctggcccaaaaggt
ccacctggaactgcaggagacatgggaccaccaggtcgtctgggagcaccaggtactcca
ggtcttccaggacccagaggtgatcctggattccaggggtttccaggcgtgaaaggagaa
aagggtaatcctggatttctaggatccattggacctccaggaccaattgggccaaaagga
ccacctggtgtacgtggagaccctggcacacttaagattatctcccttccaggaagccca
gggccacctggcacacctggagaaccagggatgcagggagaacctgggccaccagggcca
cctggaaacctaggaccctgtgggccaagaggtaagccaggcaaggatggaaaaccagga
actcctggaccagctggagaaaaaggcaacaaaggttctaaaggagagccaggaccagct
ggatcagatggattgccaggtttgaaaggaaaacgtggagacagtggatcacctgcaacc
tggacaacgagaggctttgtcttcacccgacacagtcaaaccacagcaattccttcatgt
ccagaggggacagtgccactctacagtgggttttcttttctttttgtacaaggaaatcaa
cgagcccacggacaagaccttggaactcttggcagctgcctgcagcgatttaccacaatg
ccattcttattctgcaatgtcaatgatgtatgtaattttgcatctcgaaatgattattca
tactggctgtcaacaccagctctgatgccaatgaacatggctcccattactggcagagcc
cttgagccttatataagcagatgcactgtttgtgaaggtcctgcgatcgccatagccgtt
cacagccaaaccactgacattcctccatgtcctcacggctggatttctctctggaaagga
ttttcattcatcatgttcacaagtgcaggttctgagggcaccgggcaagcactggcctcc
cctggctcctgcctggaagaattccgagccagcccatttctagaatgtcatggaagagga
acgtgcaactactattcaaattcctacagtttctggctggcttcattaaacccagaaaga
atgttcagaaagcctattccatcaactgtgaaagctggggaattagaaaaaataataagt
cgctgtcaggtgtgcatgaagaaaagacactga

DBGET integrated database retrieval system