KEGG   Homo sapiens (human): 1295
Entry
1295              CDS       T01001                                 
Symbol
COL8A1, C3orf7
Name
(RefSeq) collagen type VIII alpha 1 chain
  KO
K23455  collagen type VIII alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    1295 (COL8A1)
SSDB
Motif
Pfam: Collagen C1q BclA_C
Other DBs
NCBI-GeneID: 1295
NCBI-ProteinID: NP_001841
OMIM: 120251
HGNC: 2215
Ensembl: ENSG00000144810
Pharos: P27658(Tbio)
UniProt: P27658
Position
3:99638594..99799217
AA seq 744 aa
MAVLPGPLQLLGVLLTISLSSIRLIQAGAYYGIKPLPPQIPPQMPPQIPQYQPLGQQVPH
MPLAKDGLAMGKEMPHLQYGKEYPHLPQYMKEIQPAPRMGKEAVPKKGKEIPLASLRGEQ
GPRGEPGPRGPPGPPGLPGHGIPGIKGKPGPQGYPGVGKPGMPGMPGKPGAMGMPGAKGE
IGQKGEIGPMGIPGPQGPPGPHGLPGIGKPGGPGLPGQPGPKGDRGPKGLPGPQGLRGPK
GDKGFGMPGAPGVKGPPGMHGPPGPVGLPGVGKPGVTGFPGPQGPLGKPGAPGEPGPQGP
IGVPGVQGPPGIPGIGKPGQDGIPGQPGFPGGKGEQGLPGLPGPPGLPGIGKPGFPGPKG
DRGMGGVPGALGPRGEKGPIGAPGIGGPPGEPGLPGIPGPMGPPGAIGFPGPKGEGGIVG
PQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLG
PKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGL
HGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHA
YGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGV
YYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPS
EQAAGLYAGQYVHSSFSGYLLYPM
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggctgtgctgcctggccctctgcagctgctgggagtgctgcttaccatttccctgagt
tccatcaggctcattcaggctggtgcctactatgggatcaagccgctgccacctcaaatt
cctcctcagatgccaccacaaattccacaataccagcccctgggtcagcaagtacctcac
atgcctttggccaaagatggccttgccatgggcaaggagatgccccacttgcagtatggc
aaagagtatccacacctaccccaatatatgaaggaaattcaaccggcgccaagaatgggc
aaggaagccgtacccaagaaaggcaaagaaataccattagccagtttacgaggggaacaa
ggtccccgtggagagcctggcccaagaggaccacctgggccccctggtttgccaggtcat
gggatacctggaattaaaggaaaaccagggccacagggatatccaggagttggaaagcca
ggtatgcctggaatgccagggaagccaggagccatgggcatgcctggggcaaaaggagaa
attggacagaaaggggaaattgggcctatggggatcccaggaccacaaggacctccaggg
cctcatggacttcctggcattgggaagccaggtgggccagggttaccagggcaaccagga
ccaaagggtgatcgaggacccaaaggactaccaggacctcaaggccttcggggtcctaaa
ggagacaagggcttcgggatgccaggtgcgccaggtgtaaaggggcctccagggatgcac
ggccctcccggccctgttggactgccaggagtgggcaaaccaggagtgacaggcttccct
gggccccagggccccctgggaaagccaggggctccaggagaacctgggccacaaggccct
attggggtaccgggggttcaaggacctcctgggatacccggaattggaaagccaggccag
gatgggatcccaggccagccaggatttccaggtggcaaaggggagcaaggactgccaggg
ctaccaggacccccaggccttccagggattgggaaaccaggcttcccaggacccaaaggt
gaccggggcatgggaggtgttcctggggctcttggaccaagaggggagaaaggaccaata
ggtgccccaggaatagggggtcctccaggagagccaggcctgcctggaatcccaggtcct
atgggccctccaggtgctattggttttcctggacccaaaggagaaggtgggattgtaggg
ccacaggggccaccaggtcccaagggtgagccagggcttcaaggcttcccaggaaagcca
ggtttccttggtgaagtagggcctcctggcatgaggggtttgccaggtcccatagggccc
aagggggaagctgggcaaaaaggtgtaccaggactccctggtgttccagggcttctcgga
cctaagggagagccaggaatcccaggggatcagggtttacagggccccccaggtatccca
gggattgggggccctagtggccccattggaccacctgggattccaggccccaaaggggag
ccgggcctcccagggccccctgggttccctggtatagggaaacccggagtggcaggactt
catggccccccagggaagcctggtgcccttggtcctcaaggccagcctggccttccagga
cccccaggccctccaggacctccaggacccccagctgtgatgccccctacaccaccaccc
cagggagagtatctgccagatatggggctgggaattgatggcgtgaaacccccccatgcc
tacggggctaagaaaggcaagaatggagggccagcctatgagatgcctgcatttaccgcc
gagctaaccgcacctttcccaccggtgggggccccagtgaagtttaacaaactgctgtat
aacggcagacagaactacaacccgcagacaggcatcttcacctgtgaggtccctggtgtc
tactactttgcataccacgttcactgcaaggggggcaacgtgtgggttgctctattcaag
aacaacgagcccgtgatgtacacgtacgacgagtacaaaaagggcttcctggaccaggca
tctgggagtgcagtgctgctgctcaggcccggagaccgggtgttcctccagatgccctca
gaacaggctgcaggactgtatgccgggcagtatgtccactcctccttttcaggatattta
ttgtatcccatgtaa

DBGET integrated database retrieval system