KEGG   Homo sapiens (human): 1295Help
Entry
1295              CDS       T01001                                 

Gene name
COL8A1, C3orf7
Definition
(RefSeq) collagen type VIII alpha 1 chain
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C1q BclA_C
Motif
Other DBs
NCBI-GeneID: 1295
NCBI-ProteinID: NP_001841
OMIM: 120251
HGNC: 2215
Ensembl: ENSG00000144810
Vega: OTTHUMG00000148669
Pharos: P27658(Tbio)
UniProt: P27658
Position
3q12.1
AA seq 744 aa AA seqDB search
MAVLPGPLQLLGVLLTISLSSIRLIQAGAYYGIKPLPPQIPPQMPPQIPQYQPLGQQVPH
MPLAKDGLAMGKEMPHLQYGKEYPHLPQYMKEIQPAPRMGKEAVPKKGKEIPLASLRGEQ
GPRGEPGPRGPPGPPGLPGHGIPGIKGKPGPQGYPGVGKPGMPGMPGKPGAMGMPGAKGE
IGQKGEIGPMGIPGPQGPPGPHGLPGIGKPGGPGLPGQPGPKGDRGPKGLPGPQGLRGPK
GDKGFGMPGAPGVKGPPGMHGPPGPVGLPGVGKPGVTGFPGPQGPLGKPGAPGEPGPQGP
IGVPGVQGPPGIPGIGKPGQDGIPGQPGFPGGKGEQGLPGLPGPPGLPGIGKPGFPGPKG
DRGMGGVPGALGPRGEKGPIGAPGIGGPPGEPGLPGIPGPMGPPGAIGFPGPKGEGGIVG
PQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLG
PKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGL
HGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHA
YGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGV
YYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPS
EQAAGLYAGQYVHSSFSGYLLYPM
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgctgcctggccctctgcagctgctgggagtgctgcttaccatttccctgagt
tccatcaggctcattcaggctggtgcctactatgggatcaagccgctgccacctcaaatt
cctcctcagatgccaccacaaattccacaataccagcccctgggtcagcaagtacctcac
atgcctttggccaaagatggccttgccatgggcaaggagatgccccacttgcagtatggc
aaagagtatccacacctaccccaatatatgaaggaaattcaaccggcgccaagaatgggc
aaggaagccgtacccaagaaaggcaaagaaataccattagccagtttacgaggggaacaa
ggtccccgtggagagcctggcccaagaggaccacctgggccccctggtttgccaggtcat
gggatacctggaattaaaggaaaaccagggccacagggatatccaggagttggaaagcca
ggtatgcctggaatgccagggaagccaggagccatgggcatgcctggggcaaaaggagaa
attggacagaaaggggaaattgggcctatggggatcccaggaccacaaggacctccaggg
cctcatggacttcctggcattgggaagccaggtgggccagggttaccagggcaaccagga
ccaaagggtgatcgaggacccaaaggactaccaggacctcaaggccttcggggtcctaaa
ggagacaagggcttcgggatgccaggtgcgccaggtgtaaaggggcctccagggatgcac
ggccctcccggccctgttggactgccaggagtgggcaaaccaggagtgacaggcttccct
gggccccagggccccctgggaaagccaggggctccaggagaacctgggccacaaggccct
attggggtaccgggggttcaaggacctcctgggatacccggaattggaaagccaggccag
gatgggatcccaggccagccaggatttccaggtggcaaaggggagcaaggactgccaggg
ctaccaggacccccaggccttccagggattgggaaaccaggcttcccaggacccaaaggt
gaccggggcatgggaggtgttcctggggctcttggaccaagaggggagaaaggaccaata
ggtgccccaggaatagggggtcctccaggagagccaggcctgcctggaatcccaggtcct
atgggccctccaggtgctattggttttcctggacccaaaggagaaggtgggattgtaggg
ccacaggggccaccaggtcccaagggtgagccagggcttcaaggcttcccaggaaagcca
ggtttccttggtgaagtagggcctcctggcatgaggggtttgccaggtcccatagggccc
aagggggaagctgggcaaaaaggtgtaccaggactccctggtgttccagggcttctcgga
cctaagggagagccaggaatcccaggggatcagggtttacagggccccccaggtatccca
gggattgggggccctagtggccccattggaccacctgggattccaggccccaaaggggag
ccgggcctcccagggccccctgggttccctggtatagggaaacccggagtggcaggactt
catggccccccagggaagcctggtgcccttggtcctcaaggccagcctggccttccagga
cccccaggccctccaggacctccaggacccccagctgtgatgccccctacaccaccaccc
cagggagagtatctgccagatatggggctgggaattgatggcgtgaaacccccccatgcc
tacggggctaagaaaggcaagaatggagggccagcctatgagatgcctgcatttaccgcc
gagctaaccgcacctttcccaccggtgggggccccagtgaagtttaacaaactgctgtat
aacggcagacagaactacaacccgcagacaggcatcttcacctgtgaggtccctggtgtc
tactactttgcataccacgttcactgcaaggggggcaacgtgtgggttgctctattcaag
aacaacgagcccgtgatgtacacgtacgacgagtacaaaaagggcttcctggaccaggca
tctgggagtgcagtgctgctgctcaggcccggagaccgggtgttcctccagatgccctca
gaacaggctgcaggactgtatgccgggcagtatgtccactcctccttttcaggatattta
ttgtatcccatgtaa

DBGET integrated database retrieval system