KEGG   Homo sapiens (human): 1298Help
Entry
1298              CDS       T01001                                 

Gene name
COL9A2, DJ39G22.4, EDM2, MED, STL5
Definition
(RefSeq) collagen type IX alpha 2 chain
  KO
K08131  collagen, type IX, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04974  Protein digestion and absorption
hsa05165  Human papillomavirus infection
Disease
H00476  Multiple epiphyseal dysplasia (MED)
H02072  Stickler syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1298 (COL9A2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    1298 (COL9A2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    1298 (COL9A2)
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    1298 (COL9A2)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    1298 (COL9A2)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   1298 (COL9A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen
Motif
Other DBs
NCBI-GeneID: 1298
NCBI-ProteinID: NP_001843
OMIM: 120260
HGNC: 2218
Ensembl: ENSG00000049089
Vega: OTTHUMG00000005761
Pharos: Q14055(Tbio)
UniProt: Q14055
Position
1p34.2
AA seq 689 aa AA seqDB search
MAAATASPRSLLVLLQVVVLALAQIRGPPGERGPPGPPGPPGVPGSDGIDGDNGPPGKAG
PPGPKGEPGKAGPDGPDGKPGIDGLTGAKGEPGPMGIPGVKGQPGLPGPPGLPGPGFAGP
PGPPGPVGLPGEIGIRGPKGDPGPDGPSGPPGPPGKPGRPGTIQGLEGSADFLCPTNCPP
GMKGPPGLQGVKGHAGKRGILGDPGHQGKPGPKGDVGASGEQGIPGPPGPQGIRGYPGMA
GPKGETGPHGYKGMVGAIGATGPPGEEGPRGPPGRAGEKGDEGSPGIRGPQGITGPKGAT
GPPGINGKDGTPGTPGMKGSAGQAGQPGSPGHQGLAGVPGQPGTKGGPGDQGEPGPQGLP
GFSGPPGKEGEPGPRGEIGPQGIMGQKGDQGERGPVGQPGPQGRQGPKGEQGPPGIPGPQ
GLPGVKGDKGSPGKTGPRGKVGDPGVAGLPGEKGEKGESGEPGPKGQQGVRGEPGYPGPS
GDAGAPGVQGYPGPPGPRGLAGNRGVPGQPGRQGVEGRDATDQHIVDVALKMLQEQLAEV
AVSAKREALGAVGMMGPPGPPGPPGYPGKQGPHGHPGPRGVPGIVGAVGQIGNTGPKGKR
GEKGDPGEVGRGHPGMPGPPGIPGLPGRPGQAINGKDGDRGSPGAPGEAGRPGLPGPVGL
PGFCEPAACLGASAYASARLTEPGSIKGP
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgctacggcctccccccgcagcctccttgttctcctccaggtggtagtgctc
gctctggcgcagattagaggtccaccgggagagcggggccccccgggtcccccgggaccg
ccgggagtgcctggatccgacggcatcgacggtgacaatgggccccctggaaaagctggc
cctccgggacccaagggcgagcctggcaaagctgggccagatgggccagacgggaagccc
gggattgatggtttaactggagccaagggggagcctggccccatggggatccctggagtc
aagggccagcccgggcttcctggtcctcctggccttccgggccctggttttgctggacct
cctgggcctcctggacctgttggcctccctggtgagattggaatccgaggccccaagggg
gaccctggaccagatggaccatcggggcccccaggaccccctgggaaacctggtcgcccg
ggaaccatccagggtctggaaggcagtgcggatttcctgtgtccaaccaactgtccaccc
ggaatgaaaggtcccccagggctgcagggagtgaaggggcatgcgggcaaacgcgggatt
ctgggtgatcctggccaccaggggaagccgggtcccaagggagatgtgggtgcctctgga
gagcaaggcatccctggaccaccgggtccccagggcatcaggggctacccaggcatggca
gggcccaagggagagacgggccctcatggatataaaggcatggtgggcgctatcggtgcc
actgggccaccgggtgaggaaggtcctaggggaccgccaggccgagctggggagaagggt
gacgagggcagcccaggtattcgtggaccccaggggatcacaggcccgaaaggagcaacg
ggccccccaggcatcaacggcaaggatgggaccccaggcacgcctggcatgaagggcagt
gcaggacaggcgggacagcccggaagtccaggccaccagggcctagcgggtgtgccaggc
cagcctgggacaaaaggaggccctggagaccagggtgagccgggcccgcagggccttcct
ggattctctggtccccctgggaaagagggagagccagggcctcgaggagaaattggtccc
cagggcatcatgggacagaagggtgaccaaggcgagaggggtccagtggggcaaccaggc
cctcagggaaggcagggccctaagggggagcagggcccccccggaattccagggccccaa
ggcttgccaggcgtcaaaggagacaagggctccccagggaagaccgggccccgcggcaaa
gtgggtgacccaggggtggccggcctccccggagagaaaggcgagaagggcgagtccggc
gagccggggcccaagggacagcaaggagtacgtggagaacccggctaccctggccccagc
ggggatgcgggcgccccaggggttcagggctaccctggtccccccggccctcgaggactg
gccgggaaccgaggcgtgccaggacagcccgggagacagggcgtggagggccgggatgcc
actgaccagcacatcgtggatgtggcgctgaagatgctgcaagagcaactggcagaggtc
gccgtgagtgccaagcgggaagccctgggtgcggtgggcatgatgggtcctccaggacct
cctgggccccctgggtacccaggcaagcagggcccccatgggcaccctggccctcggggc
gttcctggcatcgtgggagccgtgggtcagatcggcaacacggggcccaagggaaaacgt
ggagagaagggtgatccaggagaagtgggacgggggcaccccgggatgcctgggccccca
gggatcccaggactccctggccggcctggccaggcaatcaacggcaaggatggagatcga
gggtccccaggggctccaggagaggcaggtcgacctggcctgccaggccccgtggggctg
ccgggcttctgtgaacctgccgcctgccttggagcttcggcctatgcctctgcccgcctt
acagagcctggatccatcaaggggccttga

DBGET integrated database retrieval system