KEGG   Homo sapiens (human): 1305Help
Entry
1305              CDS       T01001                                 

Gene name
COL13A1, CMS19, COLXIIIA1
Definition
(RefSeq) collagen type XIII alpha 1 chain
  KO
K16617  collagen, type XIII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Disease
H00770  Congenital myasthenic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    1305 (COL13A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1305 (COL13A1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   1305 (COL13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen
Motif
Other DBs
NCBI-GeneID: 1305
NCBI-ProteinID: NP_001123575
OMIM: 120350
HGNC: 2190
Ensembl: ENSG00000197467
Vega: OTTHUMG00000018394
Pharos: Q5TAT6(Tbio)
UniProt: Q5TAT6
Position
10q22.1
AA seq 717 aa AA seqDB search
MVAERTHKAAATGARGPGELGAPGTVALVAARAERGARLPSPGSCGLLTLALCSLALSLL
AHFRTAELQARVLRLEAERGEQQMETAILGRVNQLLDEKWKLHSRRRREAPKTSPGCNCP
PGPPGPTGRPGLPGDKGAIGMPGRVGSPGDAGLSIIGPRGPPGQPGTRGFPGFPGPIGLD
GKPGHPGPKGDMGLTGPPGQPGPQGQKGEKGQCGEYPHRECLSSMPAALRSSQIIALKLL
PLLNSVRLAPPPVIKRRTFQGEQSQASIQGPPGPPGPPGPSGPLGHPGLPGPMGPPGLPG
PPGPKGDPGIQGYHGRKGERGMPGMPGKHGAKGAPGIAVAGMKGEPGIPGTKGEKGAEGS
PGLPGLLGQKGEKGDAGNSIGGGRGEPGPPGLPGPPGPKGEAGVDGQVGPPGQPGDKGER
GAAGEQGPDGPKGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLPGQIGPPGAPGI
PGQKGEIGLPGPPGHDGEKGPRGKPGDMGPPGPQGPPGKDGPPGVKGENGHPGSPGEKGE
KGETGQAGSPGEKGEAGEKGNPGAEVPGLPGPEGPPGPPGLQGVPGPKGEAGLDGAKGEK
GFQGEKGDRGPLGLPGASGLDGRPGPPGTPGPIGVPGPAGPKGERGSKGDPGMTGPTGAA
GLPGLHGPPGDKGNRGERGKKGSRGPKGDKGDQGAPGLDAPCPLGEDGLPVQGCWNK
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggtagcggagcgcacccacaaagcggcagccaccggtgcccgcggccctggggagttg
ggcgcgcccgggacggtggctctggtggcggcgcgggcggagcgcggcgcacggctgccg
agtccagggtcgtgcgggctgctgacgctggccctctgctcgctggcactcagcctgctc
gcccactttcggacggccgagctgcaggcccgggtgctgcgcctggaagcggagcgcggg
gagcagcaaatggagacggctattttgggacgagtcaatcaactgctggacgagaaatgg
aagctccactcaaggaggcgccgggaggccccaaagacatctccaggatgtaactgccca
ccaggacctcctggtcccactggaagacccggactcccaggggacaaaggtgccattggg
atgcctggacgtgtggggtcccccggagacgctgggctgtccatcattggtccccgcggc
ccccctggtcaaccaggaactagaggtttccctggatttccgggtcccattgggctggac
ggcaaaccgggccacccaggaccaaagggcgacatgggtctgacgggtcccccaggacag
ccgggaccccagggacaaaaaggagaaaagggtcagtgtggagagtacccacaccgggag
tgcctaagcagcatgccagcagctctgcgctccagccaaataattgccctgaagctgctg
cctctcctcaattcagtgcgactggctccacccccggtcataaaaaggcggacgttccag
ggcgaacagagccaggccagcatccaaggtccaccagggcccccaggcccccctggacca
agtggacctctggggcacccaggactgccagggcctatggggccacctggcttacctggg
cctcctggaccaaagggagacccagggatccagggctaccacggccggaagggagaacgg
ggcatgccagggatgccaggcaagcatggagccaagggggcgcccggaattgccgtggct
gggatgaagggtgagccagggatcccaggaaccaagggtgagaagggggctgaaggctcc
cctgggcttcctggcctcctggggcagaagggagagaaaggcgatgctggcaactccatt
ggaggaggcagaggggaacctggccctccagggctccctgggcccccagggccaaaggga
gaagcaggtgtcgatggccaggttggccccccagggcagccaggagacaagggggagcgt
ggagcagctggagaacagggaccagatggccccaagggctccaagggagaaccagggaaa
ggagagatggtggattacaatggaaacatcaatgaggctctccaggagatccggacgctg
gccttgatggggcctcctggtcttcctgggcaaattggcccacctggagctccagggatt
ccaggccagaagggggagattggactgccaggccctccaggacacgatggggaaaaggga
cctcgcggtaaaccaggagacatgggccctcctggtccccaaggccccccaggaaaggat
ggacctccaggagtgaagggagaaaacgggcacccagggagcccaggagagaagggggaa
aaaggggagacaggacaagcaggctcaccgggagagaaaggagaagccggggagaagggc
aatccaggagcagaggttcctgggctgccagggccagaggggcctcccggacctccgggg
ctccaaggtgttcctggaccaaagggggaagcaggactagatggagcaaaaggagagaaa
ggcttccagggagaaaaaggagaccgtggtcccctgggactacccggagcttcaggtttg
gacggcaggcctgggccaccgggtactccaggaccaattggagttccaggcccagcggga
ccaaagggcgagaggggcagcaaaggagaccctgggatgacaggaccaacgggagcagct
gggcttcctggtttacatggaccacccggggacaagggaaaccggggggagagggggaag
aaaggctctagagggcctaaaggggataagggagaccaaggagcgcctggattagatgcc
ccctgcccattgggcgaagatggcttaccagtccaaggctgctggaacaagtga

DBGET integrated database retrieval system