KEGG   Homo sapiens (human): 1310Help
Entry
1310              CDS       T01001                                 

Gene name
COL19A1, COL9A1L, D6S228E
Definition
(RefSeq) collagen type XIX alpha 1 chain
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 1310
NCBI-ProteinID: NP_001849
OMIM: 120165
HGNC: 2196
Ensembl: ENSG00000082293
Vega: OTTHUMG00000014987
Pharos: Q14993(Tbio)
UniProt: Q14993
Position
6q13
AA seq 1142 aa AA seqDB search
MRLTGPWKLWLWMSIFLLPASTSVTVRDKTEESCPILRIEGHQLTYDNINKLEVSGFDLG
DSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKKERWFLW
QVLNQQNIPQISIVVDGGKKVVEFMFQATEGDVLNYIFRNRELRPLFDRQWHKLGISIQS
QVISLYMDCNLIARRQTDEKDTVDFHGRTVIATRASDGKPVDIELHQLKIYCSANLIAQE
TCCEISDTKCPEQDGFGNIASSWVTAHASKMSSYLPAKQELKDQCQCIPNKGEAGLPGAP
GSPGQKGHKGEPGENGLHGAPGFPGQKGEQGFEGSKGETGEKGEQGEKGDPALAGLNGEN
GLKGDLGPHGPPGPKGEKGDTGPPGPPALPGSLGIQGPQGPPGKEGQRGRRGKTGPPGKP
GPPGPPGPPGIQGIHQTLGGYYNKDNKGNDEHEAGGLKGDKGETGLPGFPGSVGPKGQKG
EPGEPFTKGEKGDRGEPGVIGSQGVKGEPGDPGPPGLIGSPGLKGQQGSAGSMGPRGPPG
DVGLPGEHGIPGKQGIKGEKGDPGGIIGPPGLPGPKGEAGPPGKSLPGEPGLDGNPGAPG
PRGPKGERGLPGVHGSPGDIGPQGIGIPGRTGAQGPAGEPGIQGPRGLPGLPGTPGTPGN
DGVPGRDGKPGLPGPPGDPIALPLLGDIGALLKNFCGNCQASVPGLKSNKGEEGGAGEPG
KYDSMARKGDIGPRGPPGIPGREGPKGSKGERGYPGIPGEKGDEGLQGIPGIPGAPGPTG
PPGLMGRTGHPGPTGAKGEKGSDGPPGKPGPPGPPGIPFNERNGMSSLYKIKGGVNVPSY
PGPPGPPGPKGDPGPVGEPGAMGLPGLEGFPGVKGDRGPAGPPGIAGMSGKPGAPGPPGV
PGEPGERGPVGDIGFPGPEGPSGKPGINGKDGIPGAQGIMGKPGDRGPKGERGDQGIPGD
RGSQGERGKPGLTGMKGAIGPMGPPGNKGSMGSPGHQGPPGSPGIPGIPADAVSFEEIKK
YINQEVLRIFEERMAVFLSQLKLPAAMLAAQAYGRPGPPGKDGLPGPPGDPGPQGYRGQK
GERGEPGIGLPGSPGLPGTSALGLPGSPGAPGPQGPPGPSGRCNPEDCLYPVSHAHQRTG
GN
NT seq 3429 nt NT seq  +upstreamnt  +downstreamnt
atgagactcactggcccttggaaactttggctttggatgtcaatatttctgcttcctgct
tccacttccgtgaccgttagggacaagacagaagagtcatgccctatcctgagaatagag
ggacatcagctgacatatgacaacataaacaaacttgaagtttcaggttttgatctagga
gacagcttttctctaagacgtgcattttgtgaaagtgataaaacctgtttcaaattggga
agtgcacttcttattagagacactattaagatatttcccaaaggccttcctgaggagtac
tcagtagctgccatgtttcgagtacgaagaaacgccaaaaaggaacggtggtttctgtgg
caggttttaaaccagcagaatattccacagatttctatagtagttgatggtggaaagaag
gtggtggaatttatgtttcaagccacagagggagatgtgttgaactacatttttagaaat
cgagaactccgtcctttgtttgatcgtcagtggcacaaacttggcattagtatacaatcc
caggtcatttcactttatatggattgtaatttaattgcgaggaggcagactgatgaaaag
gacactgtggatttccatggacggacagttattgctacgcgagcttcagatggcaagcct
gtggatattgaacttcaccaacttaaaatctactgcagtgcaaacctcatagctcaagaa
acatgttgtgaaatatcagatactaagtgcccagagcaggatggctttggaaatattgca
tcatcatgggtaactgctcatgccagtaaaatgtcttcatatctgccagcaaagcaggaa
cttaaagaccagtgccagtgcattccaaacaagggagaagcaggattaccaggagctccg
ggttcacctgggcagaaagggcataaaggagagccgggtgaaaatggtttacatggtgct
ccaggattccctggtcaaaagggagagcaaggttttgaaggcagcaaaggagaaactggt
gaaaagggtgaacaaggagaaaaaggagatccagctctggctggccttaatggagaaaat
ggtttgaaaggtgacttgggtcctcatggtccacctggcccaaaaggagaaaagggagat
acaggacccccaggaccaccagccttacctggttccctggggatacaaggcccccaaggt
ccacctggaaaagagggtcagaggggaagacgagggaaaacaggacctcccggaaaacca
ggacccccaggaccacctggacctcctggaatacaaggaatacaccaaactcttggtgga
tattataacaaggataacaagggaaatgatgaacatgaagctggaggcctgaaaggagac
aagggtgaaactggactaccaggatttccagggtctgttggccctaaaggacaaaaagga
gaacctggagagccttttacaaaaggagaaaaaggagatagaggagaacctggggtaata
ggatcacagggagtaaagggtgaacctggagatcccggaccccctggtttaataggaagc
ccaggactaaagggtcagcaaggatctgcaggctccatgggacccagaggaccgccagga
gatgttggattgccaggagaacatggtatcccaggaaaacaaggcattaaaggagaaaag
ggagatccgggtgggatcataggccctcccgggcttccaggtccaaaaggtgaggctggt
cctccagggaaaagcctgccaggggaaccaggattagatggaaatcctggagcacctggt
ccacgtgggccaaagggtgaaagaggacttccaggtgttcacggttccccaggggacata
ggcccacaagggataggaattcctggcagaacaggcgcccaaggaccagctggagagcca
ggtattcagggtcctcgaggtctccctgggttgccaggaactccagggactccagggaat
gatggagttccagggagagatggaaagccaggcctgccaggccccccaggtgacccgatt
gcacttcctctcttgggagacatcggtgctttgctcaagaatttctgtggcaactgccaa
gccagtgtcccagggctgaaaagcaacaaaggagaagaaggaggtgctggtgagcctgga
aagtatgattccatggcccggaagggtgatatagggccacggggtcctccaggaatccca
ggaagagagggaccaaagggaagcaaaggagagcggggctaccctgggatacctggggag
aaaggcgatgagggtcttcaaggaattccaggcattccaggtgctccaggcccgactgga
ccccctggcttaatgggaagaactggacatcctggtcccacaggagcaaaaggtgaaaag
ggcagcgacggaccccctgggaaacccggaccacctggaccacctggtattccatttaat
gaacgaaacggcatgagcagtttatataaaattaagggaggtgtgaatgttcccagttac
ccagggccacccggtcctcctggcccaaaaggcgatcctggcccagtgggagagcctggt
gcaatggggttgccaggattagaaggatttccaggtgtaaagggagatcgaggcccagca
ggtcccccaggaatagcagggatgtcgggaaaacctggtgccccagggcctccaggagtt
ccaggggaaccgggtgagagaggacctgttggagatataggtttccctggaccagaagga
ccctcaggaaagccaggaataaatggaaaagatggaataccaggtgctcagggcatcatg
ggtaagcctggagacagaggccccaaaggagaacgtggtgatcaggggattccaggagac
agaggctcacaaggtgaacggggaaaaccaggccttacaggcatgaagggggccatcggt
cctatgggtccaccaggaaacaagggctccatgggatcccctggccaccaaggccctcca
ggctctccaggcatccctggcattccggctgatgcagtttcatttgaagaaataaagaag
tatattaatcaagaggtcctaaggatttttgaagagaggatggctgtattcctatcccag
ctcaagctgccagcagcaatgttggctgcccaagcttatgggagacctgggccaccaggg
aaggatgggttgcctgggccaccaggagaccctggaccccaaggctacagaggacagaag
ggagaaagaggtgaacctggaattgggctgccagggagtccaggtcttcctgggacttca
gctctgggtttgccaggctcaccaggtgccccaggcccacagggccccccaggacccagt
ggaagatgtaacccagaagattgcctctatcctgtgtctcatgcccatcagcgcacaggt
gggaattga

DBGET integrated database retrieval system