KEGG   Homo sapiens (human): 131540Help
Entry
131540            CDS       T01001                                 

Gene name
ZDHHC19, DHHC19
Definition
(RefSeq) zinc finger DHHC-type palmitoyltransferase 19
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    131540 (ZDHHC19)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     131540 (ZDHHC19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 131540
NCBI-ProteinID: NP_001034706
OMIM: 618671
HGNC: 20713
Ensembl: ENSG00000163958
Vega: OTTHUMG00000133642
Pharos: Q8WVZ1(Tdark)
UniProt: Q8WVZ1
Position
3q29
AA seq 309 aa AA seqDB search
MTLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCRWLAQNGEWA
FPVITGSLFVLTFFSLVSLNFSDPGILHQGSAEQGPLTVHVVWVNHGAFRLQWCPKCCFH
RPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRFFMLLVLSLCLYSGAMLVTCLIFLV
RTTHLPFSTDKAIAIVVAVSAAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFD
QGCASNWYLTICAPLGPKYMAEAVQLQRVVGPDWTSMPNLHPPMSPSALNPPAPTSGSLQ
SREGTPGAW
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacactcttaacggatgccacgccgctggtgaaggagccccatcccctgcctctggtc
ccacgtccctggttcctccctagcctctttgctgccttcaatgtggtgctgctggtcttt
ttcagtggcctcttcttcgcattcccttgcaggtggctggctcagaacggggagtgggcc
tttcctgttatcacaggctccctctttgtccttaccttcttcagtcttgtttcactcaac
ttctcagaccctggcatcttacatcaaggctccgctgagcagggccccttgacggtgcac
gtggtgtgggtgaaccacggggccttccgcctgcaatggtgtccaaagtgctgcttccac
cgcccgccccggacttaccactgcccctggtgcaacatctgtgtggaggactttgaccac
cactgcaagtgggtcaataactgcatcggtcaccgcaacttccgcttcttcatgctgctt
gtcctgtccctgtgcctctactcgggcgccatgctggtcacctgtctcatcttcctggtg
cgcacaacccacctgcccttctccaccgacaaggccatcgccatcgtggtggccgtgtcc
gccgcgggcctcctggtgccgctgtccctcctgctgctgatccaggcactgtccgtgagc
tcggccgaccgcacctacaagggcaagtgcagacaccttcagggatacaaccccttcgac
cagggctgtgccagcaactggtatttaacaatttgtgcaccactgggacccaagtacatg
gctgaagctgtccagctgcagagagtggtggggcctgactggacatccatgccgaatctg
caccctccaatgtccccctctgctctcaaccccccagccccaacctctgggtccctacaa
agcagggaagggacccccggggcgtggtga

DBGET integrated database retrieval system