KEGG   Homo sapiens (human): 135644
Entry
135644            CDS       T01001                                 
Symbol
TRIM40, RNF35
Name
(RefSeq) tripartite motif containing 40
  KO
K12016  tripartite motif-containing protein 40
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    135644 (TRIM40)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    135644 (TRIM40)
SSDB
Motif
Pfam: zf-C3HC4 zf-RING_UBOX zf-C3HC4_4 zf-RING_2 zf-C3HC4_2 zf-C3HC4_3 zf-RING_5 zf-B_box zf-rbx1 HAUS-augmin3 Rad50_zn_hook Exonuc_VII_L
Other DBs
NCBI-GeneID: 135644
NCBI-ProteinID: NP_001273562
OMIM: 616976
HGNC: 18736
Ensembl: ENSG00000204614
Position
6:30136140..30148735
AA seq 258 aa
MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPC
SEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNR
RSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLG
QLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIY
PQLEKGVSELLLQPPQKL
NT seq 777 nt   +upstreamnt  +downstreamnt
atgatccctttgcagaaggacaaccaggaggagggtgtctgccccatctgccaggagagc
ctgaaggaggccgtgagcaccaactgcggacatctcttctgtcgagtgtgcctgacacag
catgtggagaaggcctcagcctctggggtcttctgctgccccctctgccggaagccctgt
tctgaggaggtgctagggacaggctatatctgccccaaccaccagaagagggtgtgcagg
ttctgtgaggagagcagacttcttctatgtgtggaatgcctggtgtcccctgaacacatg
tctcatcatgaactgaccattgaaaatgccctcagccactacaaggaacgactcaatcgc
cggagcaggaagctcagaaaggacattgcagaacttcagcggctcaaggctcagcaggag
aagaaactgcaggctctgcagtttcaggtagaccacgggaaccacaggctggaggctggg
ccggagagccagcaccaaaccagggaacagctgggtgccctccctcagcagtggctgggc
cagctggagcacatgccagcagaagcggccagaatccttgacatctccagggcagtaaca
cagctcagaagcctggtcattgatctggaaaggacggccaaggaattagacaccaacaca
ctgaagaatgctggtgacttactgaacaggagtgctccacagaaattagaggttatttat
ccccagttggagaaaggagtcagtgaattgcttcttcagccccctcagaagctctga

DBGET integrated database retrieval system