KEGG   Homo sapiens (human): 135892Help
Entry
135892            CDS       T01001                                 

Gene name
TRIM50, TRIM50A
Definition
(RefSeq) tripartite motif containing 50
  KO
K12024  tripartite motif-containing protein 50/73/74
Organism
hsa  Homo sapiens (human)
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    135892 (TRIM50)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    135892 (TRIM50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRY zf-RING_UBOX zf-C3HC4_4 zf-B_box zf-C3HC4_3 SPRY zf-C3HC4 zf-C3HC4_2 zf-RING_2 zf-RING_5 Prok-RING_4 Trimer_CC U-box zf-Nse zf-RING_6 DUF1644 Baculo_IE-1
Motif
Other DBs
NCBI-GeneID: 135892
NCBI-ProteinID: NP_001268380
OMIM: 612548
HGNC: 19017
Ensembl: ENSG00000146755
Vega: OTTHUMG00000156805
Pharos: Q86XT4(Tdark)
UniProt: Q86XT4 Q2M204
Position
7q11.23
AA seq 487 aa AA seqDB search
MAWQVSLPELEDRLQCPICLEVFKEPLMLQCGHSYCKGCLVSLSCHLDAELRCPVCRQAV
DGSSSLPNVSLARVIEALRLPGDPEPKVCVHHRNPLSLFCEKDQELICGLCGLLGSHQHH
PVTPVSTVYSRMKEELAALISELKQEQKKVDELIAKLVNNRTRIVNESDVFSWVIRREFQ
ELHHLVDEEKARCLEGIGGHTRGLVASLDMQLEQAQGTRERLAQAECVLEQFGNEDHHKF
IRKFHSMASRAEMPQARPLEGAFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDP
ATAHPLLELSKGNTVVQCGLLAQRRASQPERFDYSTCVLASRGFSCGRHYWEVVVGSKSD
WRLGVIKGTASRKGKLNRSPEHGVWLIGLKEGRVYEAFACPRVPLPVAGHPHRIGLYLHY
EQGELTFFDADRPDDLRPLYTFQADFQGKLYPILDTCWHERGSNSLPMVLPPPSGPGPLS
PEQPTKL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcttggcaggtgagcctgccagagctggaggaccggcttcagtgtcccatctgcctg
gaggtcttcaaggagcccctgatgctgcagtgtggccactcttactgcaagggctgcctg
gtttccctgtcctgccacctggatgccgagctgcgctgccccgtgtgccggcaggcggtg
gacggcagcagctccctgcccaacgtctccctggccagggtgatcgaagccctgaggctc
cctggggacccggagcccaaggtctgcgtgcaccaccggaacccgctcagccttttctgc
gagaaggaccaggagctcatctgtggcctctgcggtctgctgggctcccaccaacaccac
ccggtcacgcccgtctccaccgtctacagccgcatgaaggaggagctcgcagccctcatc
tctgagctgaagcaggagcagaaaaaggtggatgagctcatcgccaaactggtgaacaac
cggacccgaatcgtcaatgagtcggatgtcttcagctgggtgatccgccgcgagttccag
gagctgcaccacctggtggatgaggagaaggcccgctgcctggaggggatagggggtcac
acccgtggcctggtggcctccctggacatgcagctggagcaggcccagggaacccgggag
cggctggcccaagccgagtgtgtgctggaacagttcggcaatgaggaccaccacaagttc
atccggaagttccactccatggcctccagagcagagatgccgcaggcccggcccttagaa
ggcgcattcagccccatctccttcaagccaggcctccaccaggctgacatcaagctgacc
gtgtggaaaaggctcttccggaaagttttgccagccccggagcctctcaagttggaccct
gccactgcccacccactcctggagctctccaagggcaacacggtggtgcagtgcgggctt
ctggcccagcggcgagccagccagcctgagcgcttcgactacagcacctgcgtcctggcc
agccgcggcttctcctgcggccgccactactgggaggtggtggtgggcagcaagagcgac
tggcgcctgggggtcatcaagggcacagccagccgtaagggcaagctgaacaggtccccc
gagcacggcgtgtggctgatcggcctgaaggagggccgggtgtacgaagcctttgcctgc
ccccgggtacccctgcccgtggccggccacccccaccgcatcgggctctacctgcactat
gagcagggcgaactcaccttcttcgatgccgaccgccccgatgacctgcggccgctctac
accttccaggccgacttccagggcaagctctaccccatcctggacacctgctggcacgag
aggggcagcaactcgctgcccatggtgctgcccccgcccagcgggcctggccccctcagc
cccgagcagcccaccaagctgtag

DBGET integrated database retrieval system