KEGG   Homo sapiens (human): 138151
Entry
138151            CDS       T01001                                 
Symbol
NACC2, BEND9, BTBD14, BTBD14A, BTBD31, NAC-2, RBB
Name
(RefSeq) NACC family member 2
  KO
K10486  BTB/POZ domain-containing protein 14
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    138151 (NACC2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     138151 (NACC2)
SSDB
Motif
Pfam: BTB BEN KLHL33-like_BTB_POZ
Other DBs
NCBI-GeneID: 138151
NCBI-ProteinID: NP_653254
OMIM: 615786
HGNC: 23846
Ensembl: ENSG00000148411
Position
9:complement(136006537..136095289)
AA seq 587 aa
MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFS
GNSKSAFELPGSVPPACFQQILSFCYTGRLTMTASEQLVVMYTAGFLQIQHIVERGTDLM
FKVSSPHCDSQTAVIEDAGSEPQSPCNQLQPAAAAAAPYVVSPSVPIPLLTRVKHEAMEL
PPAGPGLAPKRPLETGPRDGVAVAAGAAVAAGTAPLKLPRVSYYGVPSLATLIPGIQQMP
YPQGERTSPGASSLPTTDSPTSYHNEEDEEDDEAYDTMVEEQYGQMYIKASGSYAVQEKP
EPVPLESRSCVLIRRDLVALPASLISQIGYRCHPKLYSEGDPGEKLELVAGSGVYITRGQ
LMNCHLCAGVKHKVLLRRLLATFFDRNTLANSCGTGIRSSTSDPSRKPLDSRVLNAVKLY
CQNFAPSFKESEMNVIAADMCTNARRVRKRWLPKIKSMLPEGVEMYRTVMGSAAASVPLD
PEFPPAAAQVFEQRIYAERRGDAATIVALRTDAVNVDLSAAANPAFDAGEEVDGAGSVIQ
EVAAPEPLPADGQSPPQPFEQGGGGPSRPQTPAAAARRPEGTYAGTL
NT seq 1764 nt   +upstreamnt  +downstreamnt
atgtctcagatgctgcacatcgagatccccaacttcgggaacacagtgctgggctgcctg
aacgagcagcgcctgctgggcctctactgcgatgtgtccatcgtggtcaagggccaggcc
ttcaaggcccaccgggcggtgctggccgccagcagcctctacttccgcgacctgttcagc
ggcaacagcaagagcgccttcgagctgcccggctccgtgccgcccgcctgcttccagcag
atcctgtccttctgctacacgggcaggctcaccatgacggccagcgagcagctcgtggtc
atgtacacggccggcttcctgcagatccagcacatcgtggagcgcggcaccgacctcatg
ttcaaggtgagctcgccccactgcgactcgcagaccgctgtgatcgaggacgccggctcc
gagccccagagcccctgcaaccagctgcagccggccgccgccgccgcggccccctacgtc
gtgtccccctcggtgcccatcccgctgctgacccgagtaaagcatgaagccatggagctg
ccgccggccggcccaggcctggcccccaagcgcccgctggagacggggccccgggacggc
gtggcggtggccgcgggggctgcggtggcggcgggcacagcccctctcaaactgccccgt
gtctcctactacggggtgcccagcctggccaccctcatccccggcatccagcagatgccc
tacccccagggggagcggaccagtccaggcgccagcagcctgcccaccaccgacagcccc
acctcgtaccacaacgaggaggacgaggaggacgacgaggcctacgacaccatggtggag
gagcagtacggccagatgtacatcaaggcctccggcagctatgcagtgcaagagaagcct
gagccagtgccgctggagagccgctcctgcgtcctcatccgccgcgacctcgtggcccta
cctgccagcctcatcagccagatcggataccgctgccatcccaagctctactcggaaggg
gaccccggggagaagctggagctggtggcaggctctggggtctacatcacacgcggccag
ctgatgaactgccacctgtgtgcaggggtgaagcataaggtcttgctgcggaggctcctg
gccaccttctttgacaggaacacgctggccaacagctgcgggactggcatccgctcgtcc
accagcgaccccagccggaagccgctggacagccgggtcctgaacgctgtgaaattgtac
tgtcagaacttcgcccccagcttcaaggagagcgagatgaacgtgatcgccgcggacatg
tgcaccaacgcccgccgcgttcgcaagcgctggctgcccaagatcaagtccatgctgccg
gagggcgtggagatgtaccgcacggtcatgggctccgccgccgccagcgtgcccctcgac
cccgagttcccgcctgccgcggcacaggtgttcgagcaacgcatctacgccgagcggcgg
ggcgacgccgccaccatcgtggctctgagaactgacgccgtgaatgttgacctgagtgcc
gccgccaaccccgccttcgacgccggcgaggaggtggacggggctggctcggtcatccag
gaggtggccgcccccgagccgctgcccgccgatggccagagccccccacagccctttgag
cagggcgggggcggccccagcaggccccagacgccggcggccgcggcccggaggccggag
ggcacctatgcagggaccttgtaa

DBGET integrated database retrieval system