KEGG   Homo sapiens (human): 138311
Entry
138311            CDS       T01001                                 
Symbol
DIPK1B, C9orf136, FAM69B, pp6977
Name
(RefSeq) divergent protein kinase domain 1B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: PIP49_C PIP49_N
Other DBs
NCBI-GeneID: 138311
NCBI-ProteinID: NP_689634
OMIM: 614543
HGNC: 28290
Ensembl: ENSG00000165716
Pharos: Q5VUD6(Tdark)
UniProt: Q5VUD6
Position
9:136712572..136724742
AA seq 431 aa
MRRLRRLAHLVLFCPFSKRLQGRLPGLRVRCIFLAWLGVFAGSWLVYVHYSSYSERCRGH
VCQVVICDQYRKGIISGSVCQDLCELHMVEWRTCLSVAPGQQVYSGLWRDKDVTIKCGIE
ETLDSKARSDAAPRRELVLFDKPTRGTSIKEFREMTLSFLKANLGDLPSLPALVGQVLLM
ADFNKDNRVSLAEAKSVWALLQRNEFLLLLSLQEKEHASRLLGYCGDLYLTEGVPHGAWH
AAALPPLLRPLLPPALQGALQQWLGPAWPWRAKIAIGLLEFVEELFHGSYGTFYMCETTL
ANVGYTATYDFKMADLQQVAPEATVRRFLQGRRCEHSTDCTYGRDCRAPCDRLMRQCKGD
LIQPNLAKVCALLRGYLLPGAPADLREELGTQLRTCTTLSGLASQVEAHHSLVLSHLKTL
LWKKISNTKYS
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgcggcggctgcggcgcctggcgcacctggtgctcttctgccccttctccaagcgcctg
cagggccggctcccaggcctcagggtccgctgcatcttcctggcctggctgggcgtcttt
gcaggcagctggctggtgtacgtgcactactcgtcctactcggagcgctgtcgcggccat
gtctgccaggtggtcatttgtgaccagtaccgcaaggggatcatctcgggctccgtctgc
caggacctgtgtgagctgcatatggtggagtggaggacctgcctctcggtggccccgggc
cagcaggtgtacagcgggctctggcgggacaaggatgtaaccatcaagtgtggcattgag
gagaccctcgactccaaggcccggtcggatgcggccccccggcgggagctggtactgttt
gacaagcccacccggggcacctccatcaaggaattccgggagatgaccctcagcttcctc
aaggcgaacctgggagacctgccttccctgccggcgctggttggccaggtcctgctcatg
gctgacttcaacaaggacaaccgggtgtccctggcggaagccaagtccgtgtgggccctg
ctgcagcgtaacgagttcctgctgctgctgtccctgcaggagaaggagcacgcctccaga
ctgctgggctactgtggggacctctacctcaccgagggcgtgccgcatggcgcctggcac
gcggccgcccttccacccctgttgcgcccactgctgccgcctgccctgcagggtgctctc
cagcagtggctggggcctgcgtggccttggcgggccaagatcgccatcggcctgctggag
ttcgtggaggagctcttccacggctcttacgggactttctacatgtgtgagaccacactg
gccaacgtgggctacacagccacctacgacttcaagatggccgacctgcagcaggtggca
cccgaggccaccgtgcgccgcttcctgcagggccgccgctgcgagcacagcaccgactgc
acctacgggcgcgactgcagggccccgtgtgacaggctcatgaggcagtgcaagggcgac
ctcatccagcccaacctggccaaggtgtgcgcactgctacggggctacctgctgcctggc
gcgcccgccgacctccgcgaggagctgggcacacagctgcgcacctgtaccacgctgagc
gggctggccagccaggtggaggcccatcactcgctggtgctcagccacctcaagactctg
ctctggaagaagatctccaacaccaagtactcttga

DBGET integrated database retrieval system