KEGG   Homo sapiens (human): 139562Help
Entry
139562            CDS       T01001                                 

Gene name
OTUD6A, DUBA2, HSHIN6
Definition
(RefSeq) OTU deubiquitinase 6A
  KO
K18342  OTU domain-containing protein 6 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    139562 (OTUD6A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     139562 (OTUD6A)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    139562 (OTUD6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTU Peptidase_C65
Motif
Other DBs
NCBI-GeneID: 139562
NCBI-ProteinID: NP_997203
OMIM: 300714
HGNC: 32312
Ensembl: ENSG00000189401
Vega: OTTHUMG00000159996
Pharos: Q7L8S5(Tbio)
UniProt: Q7L8S5
Position
Xq13.1
AA seq 288 aa AA seqDB search
MDDPKSEQQRILRRHQRERQELQAQIRSLKNSVPKTDKTKRKQLLQDVARMEAEMAQKHR
QELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEH
LAGFKREEEEKLAAILGARGLEMKAIPADGHCMYRAIQDQLVFSVSVEMLRCRTASYMKK
HVDEFLPFFSNPETSDSFGYDDFMIYCDNIVRTTAWGGQLELRALSHVLKTPIEVIQADS
PTLIIGEEYVKKPIILVYLRYAYSLGEHYNSVTPLEAGAAGGVLPRLL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggatgatccgaagagtgaacagcagcgcatactgcgccgccaccaacgcgagaggcag
gagctgcaggcccagatccggagcttaaaaaactcggtccccaagaccgacaagacgaaa
agaaagcagttgctccaagacgtggcccgcatggaggccgagatggctcagaagcaccgg
caggagctggagaagttccaagacgacagtagcattgaatctgtcgtcgaagacctggcc
aagatgaatctggaaaaccggcctccccgctcctccaaagcccacagaaagagagaaaga
atggagtccgaggagagggagcgccaggagagcatcttccaggctgagatgtcggagcac
ctggccggcttcaagcgcgaggaggaggagaagctcgccgccatcctgggagccaggggt
ctggagatgaaagcgatcccggccgacggccactgcatgtaccgcgccatccaagaccag
ctggtgttcagcgtgtctgtggagatgctgcgctgccgcaccgccagctacatgaagaag
cacgtcgacgagttcctgcccttcttcagcaaccccgagaccagcgactccttcggctac
gacgacttcatgatctactgcgacaacatcgtgcgcaccacggcatggggaggccagctg
gagctgagggccctgtcgcacgtcctgaagacccccatcgaggtgatccaggccgactcg
cccaccttgatcatcggggaggagtacgtcaagaagccgatcatcctggtctacctgcgc
tatgcctacagcctcggcgagcactacaactccgtgacaccgctcgaggccggcgccgcc
gggggcgtgctcccgcgtctcctgtag

DBGET integrated database retrieval system