KEGG   Homo sapiens (human): 1396
Entry
1396              CDS       T01001                                 
Symbol
CRIP1, CRHP, CRIP, CRP-1, CRP1
Name
(RefSeq) cysteine rich protein 1
  KO
K24412  cysteine-rich protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    1396 (CRIP1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 LIM domain-containing proteins
  CRP family proteins
   1396 (CRIP1)
SSDB
Motif
Pfam: LIM zf_UBZ YacG Sgf11 zf-ACC DUF2321 TackOD1 Mut7-C CPxCG_zf
Other DBs
NCBI-GeneID: 1396
NCBI-ProteinID: NP_001302
OMIM: 123875
HGNC: 2360
Ensembl: ENSG00000213145
Pharos: P50238(Tbio)
UniProt: P50238
Position
14:105486886..105488947
AA seq 77 aa
MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAM
FGPKGFGRGGAESHTFK
NT seq 234 nt   +upstreamnt  +downstreamnt
atgcccaagtgtcccaagtgcaacaaggaggtgtacttcgccgagagggtgacctctctg
ggcaaggactggcatcggccctgcctgaagtgcgagaaatgtgggaagacgctgacctct
gggggccacgctgagcacgaaggcaaaccctactgcaaccacccctgctacgcagccatg
tttgggcctaaaggctttgggcggggcggagccgagagccacactttcaagtaa

DBGET integrated database retrieval system