KEGG   Homo sapiens (human): 14
Entry
14                CDS       T01001                                 

Symbol
AAMP
Name
(RefSeq) angio associated migratory cell protein
  KO
K24725  angio-associated migratory cell protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    14 (AAMP)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 WD40 repeat (WDR) domain-containing proteins
  Other WDR domain-containing proteins
   14 (AAMP)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 WD40_like Nup160 RAB3GAP2_N
Other DBs
NCBI-GeneID: 14
NCBI-ProteinID: NP_001078
OMIM: 603488
HGNC: 18
Ensembl: ENSG00000127837
Vega: OTTHUMG00000155202
Pharos: Q13685(Tbio)
UniProt: Q13685
Position
2q35
AA seq 434 aa
MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDVDFEEEEEEEG
NEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWR
LSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWM
EWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIR
IWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRP
ETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQTLRHQCQHQSG
IVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSG
DHKAKVFCVQRPDR
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggagtccgaatcggaaagcggggctgctgctgacacccccccactggagaccctaagc
ttccatggtgatgaagagattatcgaggtggtagaacttgatcccggtccgccggaccca
gatgacctggcccaggagatggaagatgtggactttgaggaagaagaggaggaagagggc
aacgaagagggctgggttctagaaccccaggaaggggtggtcggcagcatggagggcccc
gacgatagcgaggtcacctttgcattgcactcagcatctgtgttttgtgtgagcctggac
cccaagaccaataccttggcagtgaccgggggtgaagatgacaaagccttcgtatggcgg
ctcagcgatggggagctgctctttgagtgtgcaggccataaagactctgtgacttgtgct
ggtttcagccatgactccactctagtggccacaggggacatgagtggcctcttgaaagtg
tggcaggtggacactaaggaggaggtctggtcctttgaagcgggagacctggagtggatg
gagtggcatcctcgggcacctgtcctgttggcgggcacagctgacggcaacacctggatg
tggaaagtcccgaatggtgactgcaagaccttccagggtcccaactgcccagccacctgt
ggccgagtcctccctgatgggaagagagctgtggtaggctatgaagatgggaccatcagg
atttgggacctgaagcagggaagccctatccatgtactgaaagggactgagggtcaccag
ggcccactcacctgtgttgctgccaaccaggatggcagcttgatcctaactggctctgtg
gactgccaggccaagctggtcagtgccaccaccggcaaggtggtgggtgtttttagacct
gagactgtggcctcccagcccagcctgggagaaggggaggagagtgagtccaactcggtg
gagtccttgggcttctgcagtgtgatgcccctggcagctgttggctacctggatgggacc
ttggccatctatgacctggctacgcagactcttaggcatcagtgtcagcaccagtcgggc
atcgtgcagctgctgtgggaggcaggcactgccgtggtatatacctgcagcctggatggc
atcgtgcgcctctgggacgcccggaccggccgcctgcttactgactaccggggccacacg
gctgagatcctggactttgccctcagcaaagatgcctccctggtggtgaccacgtcagga
gaccacaaagcgaaagtattttgtgtccaaaggcctgaccgttaa

DBGET integrated database retrieval system