KEGG   Homo sapiens (human): 1404Help
Entry
1404              CDS       T01001                                 

Gene name
HAPLN1, CRT1, CRTL1
Definition
(RefSeq) hyaluronan and proteoglycan link protein 1
  KO
K06848  hyaluronan and proteoglycan link protein 1
Organism
hsa  Homo sapiens (human)
Brite
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   1404 (HAPLN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xlink V-set Ig_3 Chordopox_A33R Ig_2 I-set ig
Motif
Other DBs
NCBI-GeneID: 1404
NCBI-ProteinID: NP_001875
OMIM: 115435
HGNC: 2380
Ensembl: ENSG00000145681
Vega: OTTHUMG00000119045
Pharos: P10915(Tbio)
UniProt: P10915 A0A024RAK9
Position
5q14.3
AA seq 354 aa AA seqDB search
MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLP
CKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDS
DASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQA
CLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGF
WDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILG
YDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtctacttcttctggtgctgatttcaatctgctgggctgatcatctttcagac
aactatactctggatcatgacagagctattcacatccaagcagaaaatggcccccatcta
cttgtggaagcagagcaagccaaggtgttttcacacagaggtggcaatgttacactgcca
tgtaaattttatcgagaccctacagcatttggctcaggaatccataaaatccgaattaag
tggaccaagctaacttcggattacctcaaggaagtggatgtttttgtttccatgggatac
cacaaaaaaacctatggaggctaccagggtagagtgtttctgaagggaggcagtgatagt
gatgcttctctggtcatcacagacctcactctggaagattatgggagatataagtgtgag
gtgattgaaggattagaagatgatactgttgtggtagcactggacttacaaggtgtggta
ttcccttactttccacgactggggcgctacaatctcaattttcacgaggcgcagcaggcg
tgtctggaccaggatgctgtgatcgcctccttcgaccagctgtacgacgcctggcggggc
gggctggactggtgcaatgccggctggctcagtgatggctctgtgcaatatcccatcaca
aagcccagagagccctgtggggggcagaacacagtgcccggagtcaggaactacggattt
tgggataaagataaaagcagatatgatgttttctgttttacatccaatttcaatggccgt
ttttactatctgatccaccccaccaaactgacctatgatgaagcggtgcaagcttgtctc
aatgatggtgctcagattgcaaaagtgggccagatatttgctgcctggaaaattctcgga
tatgaccgctgtgatgcgggctggttggcggatggcagcgtccgctaccccatctctagg
ccaagaaggcgctgcagtcctactgaggctgcagtgcgcttcgtgggtttcccagataaa
aagcataagctgtatggtgtctactgcttcagagcatacaactga

DBGET integrated database retrieval system