KEGG   Homo sapiens (human): 1438Help
Entry
1438              CDS       T01001                                 

Gene name
CSF2RA, CD116, CDw116, CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF-R-alpha, GMCSFR, GMR, SMDP4, alphaGMR
Definition
(RefSeq) colony stimulating factor 2 receptor alpha subunit
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Disease
H01122  Congenital pulmonary alveolar proteinosis
Drug target
Mavrilimumab: D09930
Molgramostim: D05066
Regramostim: D05712
Sargramostim: D05803
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    1438 (CSF2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1438 (CSF2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1438 (CSF2RA)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    1438 (CSF2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    1438 (CSF2RA)
   04090 CD molecules [BR:hsa04090]
    1438 (CSF2RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL3 receptor family
   1438 (CSF2RA)
CD molecules [BR:hsa04090]
 Proteins
  1438 (CSF2RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL3Ra_N IL6Ra-bind
Motif
Other DBs
NCBI-GeneID: 1438
NCBI-ProteinID: NP_001155001
OMIM: 306250 425000
HGNC: 2435
Ensembl: ENSG00000198223
Vega: OTTHUMG00000012533
Pharos: P15509(Tclin)
UniProt: P15509
Structure
PDB: 

Position
Xp22.33 and Yp11.2
AA seq 400 aa AA seqDB search
MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKC
FLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTA
AQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHL
DNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQP
RTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAAD
VRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVP
QIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcctggtgacaagccttctgctctgtgagttaccacacccagcattcctcctg
atcccagagaaatcggatctgcgaacagtggcaccagcctctagtctcaatgtgaggttt
gactccaggacgatgaatttaagctgggactgccaagaaaacacaaccttcagcaagtgt
ttcttaactgacaagaagaacagagtcgtggaacccaggctcagtaacaacgaatgttcg
tgcacatttcgtgaaatttgtctgcatgaaggagtcacatttgaggttcacgtgaatact
agtcaaagaggatttcaacagaaactgctttatccaaattcaggaagggagggtaccgct
gctcagaatttctcctgtttcatctacaatgcggatttaatgaactgtacctgggcgagg
ggtccgacggccccccgtgacgtccagtattttttgtacatacgaaactcaaagagaagg
agggagatccggtgtccttattacatacaagactcaggaacccatgtgggatgtcacctg
gataacctgtcaggattaacgtctcgcaattactttctggttaacggaaccagccgagaa
attggcatccaattctttgattcacttttggacacaaagaaaatagaacgattcaaccct
cccagcaatgtcaccgtacgttgcaacacgacgcactgcctcgtacggtggaaacagccc
aggacctatcagaagctgtcgtacctggactttcagtaccagctggacgtccacagaaag
aatacccagcctggcacggaaaacctactgattaatgtttctggtgatttggaaaataga
tacaactttccaagctctgagcccagagcaaaacacagtgtgaagatcagagctgcagac
gtccgcatcttgaattggagctcctggagtgaagccattgaatttggttctgacgacggg
aacctcggctctgtgtacatttatgtgctcctaatcgtgggaacccttgtctgtggcatc
gtcctcggcttcctctttaaaaggttccttaggatacagcggctgttcccgccagttcca
cagatcaaagacaaactgaatgataaccatgaggtggaagacgagatcatctgggaggaa
ttcaccccagaggaagggaaaggctaccgcgaagaggtcttgaccgtgaaggaaattacc
tga

DBGET integrated database retrieval system