KEGG   Homo sapiens (human): 1438Help
Entry
1438              CDS       T01001                                 

Gene name
CSF2RA, CD116, CDw116, CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF-R-alpha, GMCSFR, GMR, SMDP4, alphaGMR
Definition
(RefSeq) colony stimulating factor 2 receptor alpha subunit
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Disease
H01122  Congenital pulmonary alveolar proteinosis
Drug target
Mavrilimumab: D09930
Molgramostim: D05066
Regramostim: D05712
Sargramostim: D05803
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    1438 (CSF2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1438 (CSF2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1438 (CSF2RA)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    1438 (CSF2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    1438 (CSF2RA)
   04090 CD Molecules [BR:hsa04090]
    1438 (CSF2RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL3 receptor family
   1438 (CSF2RA)
CD molecules [BR:hsa04090]
 Proteins
  1438 (CSF2RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind
Motif
Other DBs
NCBI-GeneID: 1438
NCBI-ProteinID: NP_001155001
OMIM: 306250 425000
HGNC: 2435
Ensembl: ENSG00000198223
Vega: OTTHUMG00000012533
Pharos: P15509(Tclin)
UniProt: P15509
Structure
PDB: 

Position
Xp22.33 and Yp11.2
AA seq 400 aa AA seqDB search
MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKC
FLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTA
AQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHL
DNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQP
RTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAAD
VRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVP
QIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcctggtgacaagccttctgctctgtgagttaccacacccagcattcctcctg
atcccagagaaatcggatctgcgaacagtggcaccagcctctagtctcaatgtgaggttt
gactccaggacgatgaatttaagctgggactgccaagaaaacacaaccttcagcaagtgt
ttcttaactgacaagaagaacagagtcgtggaacccaggctcagtaacaacgaatgttcg
tgcacatttcgtgaaatttgtctgcatgaaggagtcacatttgaggttcacgtgaatact
agtcaaagaggatttcaacagaaactgctttatccaaattcaggaagggagggtaccgct
gctcagaatttctcctgtttcatctacaatgcggatttaatgaactgtacctgggcgagg
ggtccgacggccccccgtgacgtccagtattttttgtacatacgaaactcaaagagaagg
agggagatccggtgtccttattacatacaagactcaggaacccatgtgggatgtcacctg
gataacctgtcaggattaacgtctcgcaattactttctggttaacggaaccagccgagaa
attggcatccaattctttgattcacttttggacacaaagaaaatagaacgattcaaccct
cccagcaatgtcaccgtacgttgcaacacgacgcactgcctcgtacggtggaaacagccc
aggacctatcagaagctgtcgtacctggactttcagtaccagctggacgtccacagaaag
aatacccagcctggcacggaaaacctactgattaatgtttctggtgatttggaaaataga
tacaactttccaagctctgagcccagagcaaaacacagtgtgaagatcagagctgcagac
gtccgcatcttgaattggagctcctggagtgaagccattgaatttggttctgacgacggg
aacctcggctctgtgtacatttatgtgctcctaatcgtgggaacccttgtctgtggcatc
gtcctcggcttcctctttaaaaggttccttaggatacagcggctgttcccgccagttcca
cagatcaaagacaaactgaatgataaccatgaggtggaagacgagatcatctgggaggaa
ttcaccccagaggaagggaaaggctaccgcgaagaggtcttgaccgtgaaggaaattacc
tga

DBGET integrated database retrieval system