KEGG   Homo sapiens (human): 1445Help
Entry
1445              CDS       T01001                                 

Gene name
CSK
Definition
(RefSeq) C-terminal Src kinase
  KO
K05728  c-src tyrosine kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    1445 (CSK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1445 (CSK)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1445 (CSK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     1445 (CSK)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  CSK family
   1445 (CSK)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   1445 (CSK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 APH SH3_3
Motif
Other DBs
NCBI-GeneID: 1445
NCBI-ProteinID: NP_001120662
OMIM: 124095
HGNC: 2444
Ensembl: ENSG00000103653
Vega: OTTHUMG00000142814
Pharos: P41240(Tchem)
UniProt: P41240 B2R6Q4 A8K3B6
Structure
PDB: 

Position
15q24.1
AA seq 450 aa AA seqDB search
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaatacaggccgcctggccatccggtacagaatgtattgccaagtacaacttc
cacggcactgccgagcaggacctgcccttctgcaaaggagacgtgctcaccattgtggcc
gtcaccaaggaccccaactggtacaaagccaaaaacaaggtgggccgtgagggcatcatc
ccagccaactacgtccagaagcgggagggcgtgaaggcgggtaccaaactcagcctcatg
ccttggttccacggcaagatcacacgggagcaggctgagcggcttctgtacccgccggag
acaggcctgttcctggtgcgggagagcaccaactaccccggagactacacgctgtgcgtg
agctgcgacggcaaggtggagcactaccgcatcatgtaccatgccagcaagctcagcatc
gacgaggaggtgtactttgagaacctcatgcagctggtggagcactacacctcagacgca
gatggactctgtacgcgcctcattaaaccaaaggtcatggagggcacagtggcggcccag
gatgagttctaccgcagcggctgggccctgaacatgaaggagctgaagctgctgcagacc
atcgggaagggggagttcggagacgtgatgctgggcgattaccgagggaacaaagtcgcc
gtcaagtgcattaagaacgacgccactgcccaggccttcctggctgaagcctcagtcatg
acgcaactgcggcatagcaacctggtgcagctcctgggcgtgatcgtggaggagaagggc
gggctctacatcgtcactgagtacatggccaaggggagccttgtggactacctgcggtct
aggggtcggtcagtgctgggcggagactgtctcctcaagttctcgctagatgtctgcgag
gccatggaatacctggagggcaacaatttcgtgcatcgagacctggctgcccgcaatgtg
ctggtgtctgaggacaacgtggccaaggtcagcgactttggtctcaccaaggaggcgtcc
agcacccaggacacgggcaagctgccagtcaagtggacagcccctgaggccctgagagag
aagaaattctccactaagtctgacgtgtggagtttcggaatccttctctgggaaatctac
tcctttgggcgagtgccttatccaagaattcccctgaaggacgtcgtccctcgggtggag
aagggctacaagatggatgcccccgacggctgcccgcccgcagtctatgaagtcatgaag
aactgctggcacctggacgccgccatgcggccctccttcctacagctccgagagcagctt
gagcacatcaaaacccacgagctgcacctgtga

DBGET integrated database retrieval system