KEGG   Homo sapiens (human): 1462Help
Entry
1462              CDS       T01001                                 

Gene name
VCAN, CSPG2, ERVR, GHAP, PG-M, WGN, WGN1
Definition
(RefSeq) versican
  KO
K06793  versican core protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Disease
H00805  Vitreoretinal degeneration
H02073  Wagner syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1462 (VCAN)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   1462 (VCAN)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   1462 (VCAN)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   1462 (VCAN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xlink Lectin_C V-set EGF hEGF Sushi EGF_2 EGF_CA
Motif
Other DBs
NCBI-GeneID: 1462
NCBI-ProteinID: NP_004376
OMIM: 118661
HGNC: 2464
Ensembl: ENSG00000038427
Vega: OTTHUMG00000131321
Pharos: P13611(Tbio)
UniProt: P13611 A0A024RAQ9 Q59FG9
Position
5q14.2-q14.3
AA seq 3396 aa AA seqDB search
MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSE
FLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKL
LASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAAQKACLDVGAVIA
TPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYD
VYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLS
DASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKEATTIDLSILA
ETASPSLSKEPQMVSDRTTPIIPLVDELPVIPTEFPPVGNIVSFEQKATVQPQAITDSLA
TKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVED
KQTQESVTQIEQIEVGPLVTSMEILKHIPSKEFPVTETPLVTARMILESKTEKKMVSTVS
ELVTTGHYGFTLGEEDDEDRTLTVGSDESTLIFDQIPEVITVSKTSEDTIHTHLEDLESV
SASTTVSPLIMPDNNGSSMDDWEERQTSGRITEEFLGKYLSTTPFPSQHRTEIELFPYSG
DKILVEGISTVIYPSLQTEMTHRRERTETLIPEMRTDTYTDEIQEEITKSPFMGKTEEEV
FSGMKLSTSLSEPIHVTESSVEMTKSFDFPTLITKLSAEPTEVRDMEEDFTATPGTTKYD
ENITTVLLAHGTLSVEAATVSKWSWDEDNTTSKPLESTEPSASSKLPPALLTTVGMNGKD
KDIPSFTEDGADEFTLIPDSTQKQLEEVTDEDIAAHGKFTIRFQPTTSTGIAEKSTLRDS
TTEEKVPPITSTEGQVYATMEGSALGEVEDVDLSKPVSTVPQFAHTSEVEGLAFVSYSST
QEPTTYVDSSHTIPLSVIPKTDWGVLVPSVPSEDEVLGEPSQDILVIDQTRLEATISPET
MRTTKITEGTTQEEFPWKEQTAEKPVPALSSTAWTPKEAVTPLDEQEGDGSAYTVSEDEL
LTGSERVPVLETTPVGKIDHSVSYPPGAVTEHKVKTDEVVTLTPRIGPKVSLSPGPEQKY
ETEGSSTTGFTSSLSPFSTHITQLMEETTTEKTSLEDIDLGSGLFEKPKATELIEFSTIK
VTVPSDITTAFSSVDRLHTTSAFKPSSAITKKPPLIDREPGEETTSDMVIIGESTSHVPP
TTLEDIVAKETETDIDREYFTTSSPPATQPTRPPTVEDKEAFGPQALSTPQPPASTKFHP
DINVYIIEVRENKTGRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIE
IDLYHSEENEEEEEECANATDVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPS
QNFSDSSESDTHPFVIAKTELSTAVQPNESTETTESLEVTWKPETYPETSEHFSGGEPDV
FPTVPFHEEFESGTAKKGAESVTERDTEVGHQAHEHTEPVSLFPEESSGEIAIDQESQKI
AFARATEVTFGEEVEKSTSVTYTPTIVPSSASAYVSEEEAVTLIGNPWPDDLLSTKESWV
EATPRQVVELSGSSSIPITEGSGEAEEDEDTMFTMVTDLSQRNTTDTLITLDTSRIITES
FFEVPATTIYPVSEQPSAKVVPTKFVSETDTSEWISSTTVEEKKRKEEEGTTGTASTFEV
YSSTQRSDQLILPFELESPNVATSSDSGTRKSFMSLTTPTQSEREMTDSTPVFTETNTLE
NLGAQTTEHSSIHQPGVQEGLTTLPRSPASVFMEQGSGEAAADPETTTVSSFSLNVEYAI
QAEKEVAGTLSPHVETTFSTEPTGLVLSTVMDRVVAENITQTSREIVISERLGEPNYGAE
IRGFSTGFPLEEDFSGDFREYSTVSHPIAKEETVMMEGSGDAAFRDTQTSPSTVPTSVHI
SHISDSEGPSSTMVSTSAFPWEEFTSSAEGSGEQLVTVSSSVVPVLPSAVQKFSGTASSI
IDEGLGEVGTVNEIDRRSTILPTAEVEGTKAPVEKEEVKVSGTVSTNFPQTIEPAKLWSR
QEVNPVRQEIESETTSEEQIQEEKSFESPQNSPATEQTIFDSQTFTETELKTTDYSVLTT
KKTYSDDKEMKEEDTSLVNMSTPDPDANGLESYTTLPEATEKSHFFLATALVTESIPAEH
VVTDSPIKKEESTKHFPKGMRPTIQESDTELLFSGLGSGEEVLPTLPTESVNFTEVEQIN
NTLYPHTSQVESTSSDKIEDFNRMENVAKEVGPLVSQTDIFEGSGSVTSTTLIEILSDTG
AEGPTVAPLPFSTDIGHPQNQTVRWAEEIQTSRPQTITEQDSNKNSSTAEINETTTSSTD
FLARAYGFEMAKEFVTSAPKPSDLYYEPSGEGSGEVDIVDSFHTSATTQATRQESSTTFV
SDGSLEKHPEVPSAKAVTADGFPTVSVMLPLHSEQNKSSPDPTSTLSNTVSYERSTDGSF
QDRFREFEDSTLKPNRKKPTENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDI
DHTKPVYEDILGMQTDIDTEVPSEPHDSNDESNDDSTQVQEIYEAAVNLSLTEETFEGSA
DVLASYTQATHDESMTYEDRSQLDHMGFHFTTGIPAPSTETELDVLLPTATSLPIPRKSA
TVIPEIEGIKAEAKALDDMFESSTLSDGQAIADQSEIIPTLGQFERTQEEYEDKKHAGPS
FQPEFSSGAEEALVDHTPYLSIATTHLMDQSVTEVPDVMEGSNPPYYTDTTLAVSTFAKL
SSQTPSSPLTIYSGSEASGHTEIPQPSALPGIDVGSSVMSPQDSFKEIHVNIEATFKPSS
EEYLHITEPPSLSPDTKLEPSEDDGKPELLEEMEASPTELIAVEGTEILQDFQNKTDGQV
SGEAIKMFPTIKTPEAGTVITTADEIELEGATQWPHSTSASATYGVEAGVVPWLSPQTSE
RPTLSSSPEINPETQAALIRGQDSTIAASEQQVAARILDSNDQATVNPVEFNTEVATPPF
SLLETSNETDFLIGINEESVEGTAIYLPGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYS
GDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQC
YKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWT
DGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPP
VVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQR
TYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR
NT seq 10191 nt NT seq  +upstreamnt  +downstreamnt
atgttcataaatataaagagcatcttatggatgtgttcaaccttaatagtaacccatgcg
ctacataaagtcaaagtgggaaaaagcccaccggtgaggggctccctctctggaaaagtc
agcctaccttgtcatttttcaacgatgcctactttgccacccagttacaacaccagtgaa
tttctccgcatcaaatggtctaagattgaagtggacaaaaatggaaaagatttgaaagag
actactgtccttgtggcccaaaatggaaatatcaagattggtcaggactacaaagggaga
gtgtctgtgcccacacatcccgaggctgtgggcgatgcctccctcactgtggtcaagctg
ctggcaagtgatgcgggtctttaccgctgtgacgtcatgtacgggattgaagacacacaa
gacacggtgtcactgactgtggatggggttgtgtttcactacagggcggcaaccagcagg
tacacactgaattttgaggctgctcagaaggcttgtttggacgttggggcagtcatagca
actccagagcagctctttgctgcctatgaagatggatttgagcagtgtgacgcaggctgg
ctggctgatcagactgtcagatatcccatccgggctcccagagtaggctgttatggagat
aagatgggaaaggcaggagtcaggacttatggattccgttctccccaggaaacttacgat
gtgtattgttatgtggatcatctggatggtgatgtgttccacctcactgtccccagtaaa
ttcaccttcgaggaggctgcaaaagagtgtgaaaaccaggatgccaggctggcaacagtg
ggggaactccaggcggcatggaggaacggctttgaccagtgcgattacgggtggctgtcg
gatgccagcgtgcgccaccctgtgactgtggccagggcccagtgtggaggtggtctactt
ggggtgagaaccctgtatcgttttgagaaccagacaggcttccctccccctgatagcaga
tttgatgcctactgctttaaacctaaagaggctacaaccatcgatttgagtatcctcgca
gaaactgcatcacccagtttatccaaagaaccacaaatggtttctgatagaactacacca
atcatccctttagttgatgaattacctgtcattccaacagagttccctcccgtgggaaat
attgtcagttttgaacagaaagccacagtccaacctcaggctatcacagatagtttagcc
accaaattacccacacctactggcagtaccaagaagccctgggatatggatgactactca
ccttctgcttcaggacctcttggaaagctagacatatcagaaattaaggaagaagtgctc
cagagtacaactggcgtctctcattatgctacggattcatgggatggtgtcgtggaagat
aaacaaacacaagaatcggttacacagattgaacaaatagaagtgggtcctttggtaaca
tctatggaaatcttaaagcacattccttccaaggaattccctgtaactgaaacaccattg
gtaactgcaagaatgatcctggaatccaaaactgaaaagaaaatggtaagcactgtttct
gaattggtaaccacaggtcactatggattcaccttgggagaagaggatgatgaagacaga
acacttacagttggatctgatgagagcaccttgatctttgaccaaattcctgaagtcatt
acggtgtcaaagacttcagaagacaccatccacactcatttagaagacttggagtcagtc
tcagcatccacaactgtttcccctttaattatgcctgataataatggatcatccatggat
gactgggaagagagacaaactagtggtaggataacggaagagtttcttggcaaatatctg
tctactacaccttttccatcacagcatcgtacagaaatagaattgtttccttattctggt
gataaaatattagtagagggaatttccacagttatttatccttctctacaaacagaaatg
acacatagaagagaaagaacagaaacactaataccagagatgagaacagatacttataca
gatgaaatacaagaagagatcactaaaagtccatttatgggaaaaacagaagaagaagtc
ttctctgggatgaaactctctacatctctctcagagccaattcatgttacagagtcttct
gtggaaatgaccaagtcttttgatttcccaacattgataacaaagttaagtgcagagcca
acagaagtaagagatatggaggaagactttacagcaactccaggtactacaaaatatgat
gaaaatattacaacagtgcttttggcccatggtactttaagtgttgaagcagccactgta
tcaaaatggtcatgggatgaagataatacaacatccaagcctttagagtctacagaacct
tcagcctcttcaaaattgccccctgccttactcacaactgtggggatgaatggaaaggat
aaagacatcccaagtttcactgaagatggagcagatgaatttactcttattccagatagt
actcaaaagcagttagaggaggttactgatgaagacatagcagcccatggaaaattcaca
attagatttcagccaactacatcaactggtattgcagaaaagtcaactttgagagattct
acaactgaagaaaaagttccacctatcacaagcactgaaggccaagtttatgcaaccatg
gaaggaagtgctttgggtgaagtagaagatgtggacctctctaagccagtatctactgtt
ccccaatttgcacacacttcagaggtggaaggattagcatttgttagttatagtagcacc
caagagcctactacttatgtagactcttcccataccattcctctttctgtaattcccaag
acagactggggagtgttagtaccttctgttccatcagaagatgaagttctaggtgaaccc
tctcaagacatacttgtcattgatcagactcgccttgaagcgactatttctccagaaact
atgagaacaacaaaaatcacagagggaacaactcaggaagaattcccttggaaagaacag
actgcagagaaaccagttcctgctctcagttctacagcttggactcccaaggaggcagta
acaccactggatgaacaagagggcgatggatcagcatatacagtctctgaagatgaattg
ttgacaggttctgagagggtcccagttttagaaacaactccagttggaaaaattgatcac
agtgtgtcttatccaccaggtgctgtaactgagcacaaagtgaaaacagatgaagtggta
acactaacaccacgcattgggccaaaagtatctttaagtccagggcctgaacaaaaatat
gaaacagaaggtagtagtacaacaggatttacatcatctttgagtccttttagtacccac
attacccagcttatggaagaaaccactactgagaaaacatccctagaggatattgattta
ggctcaggattatttgaaaagcccaaagccacagaactcatagaattttcaacaatcaaa
gtcacagttccaagtgatattaccactgccttcagttcagtagacagacttcacacaact
tcagcattcaagccatcttccgcgatcactaagaaaccacctctcatcgacagggaacct
ggtgaagaaacaaccagtgacatggtaatcattggagaatcaacatctcatgttcctccc
actacccttgaagatattgtagccaaggaaacagaaaccgatattgatagagagtatttc
acgacttcaagtcctcctgctacacagccaacaagaccacccactgtggaagacaaagag
gcctttggacctcaggcgctttctacgccacagcccccagcaagcacaaaatttcaccct
gacattaatgtttatattattgaggtcagagaaaataagacaggtcgaatgagtgatttg
agtgtaattggtcatccaatagattcagaatctaaagaagatgaaccttgtagtgaagaa
acagatccagtgcatgatctaatggctgaaattttacctgaattccctgacataattgaa
atagacctataccacagtgaagaaaatgaagaagaagaagaagagtgtgcaaatgctact
gatgtgacaaccaccccatctgtgcagtacataaatgggaagcatctcgttaccactgtg
cccaaggacccagaagctgcagaagctaggcgtggccagtttgaaagtgttgcaccttct
cagaatttctcggacagctctgaaagtgatactcatccatttgtaatagccaaaacggaa
ttgtctactgctgtgcaacctaatgaatctacagaaacaactgagtctcttgaagttaca
tggaagcctgagacttaccctgaaacatcagaacatttttcaggtggtgagcctgatgtt
ttccccacagtcccattccatgaggaatttgaaagtggaacagccaaaaaaggggcagaa
tcagtcacagagagagatactgaagttggtcatcaggcacatgaacatactgaacctgta
tctctgtttcctgaagagtcttcaggagagattgccattgaccaagaatctcagaaaata
gcctttgcaagggctacagaagtaacatttggtgaagaggtagaaaaaagtacttctgtc
acatacactcccactatagttccaagttctgcatcagcatatgtttcagaggaagaagca
gttaccctaataggaaatccttggccagatgacctgttgtctaccaaagaaagctgggta
gaagcaactcctagacaagttgtagagctctcagggagttcttcgattccaattacagaa
ggctctggagaagcagaagaagatgaagatacaatgttcaccatggtaactgatttatca
cagagaaatactactgatacactcattactttagacactagcaggataatcacagaaagc
ttttttgaggttcctgcaaccaccatttatccagtttctgaacaaccttctgcaaaagtg
gtgcctaccaagtttgtaagtgaaacagacacttctgagtggatttccagtaccactgtt
gaggaaaagaaaaggaaggaggaggagggaactacaggtacggcttctacatttgaggta
tattcatctacacagagatcggatcaattaattttaccctttgaattagaaagtccaaat
gtagctacatctagtgattcaggtaccaggaaaagttttatgtccttgacaacaccaaca
cagtctgaaagggaaatgacagattctactcctgtctttacagaaacaaatacattagaa
aatttgggggcacagaccactgagcacagcagtatccatcaacctggggttcaggaaggg
ctgaccactctcccacgtagtcctgcctctgtctttatggagcagggctctggagaagct
gctgccgacccagaaaccaccactgtttcttcattttcattaaacgtagagtatgcaatt
caagccgaaaaggaagtagctggcactttgtctccgcatgtggaaactacattctccact
gagccaacaggactggttttgagtacagtaatggacagagtagttgctgaaaatataacc
caaacatccagggaaatagtgatttcagagcgattaggagaaccaaattatggggcagaa
ataaggggcttttccacaggttttcctttggaggaagatttcagtggtgactttagagaa
tactcaacagtgtctcatcccatagcaaaagaagaaacggtaatgatggaaggctctgga
gatgcagcatttagggacacccagacttcaccatctacagtacctacttcagttcacatc
agtcacatatctgactcagaaggacccagtagcaccatggtcagcacttcagccttcccc
tgggaagagtttacatcctcagctgagggctcaggtgagcaactggtcacagtcagcagc
tctgttgttccagtgcttcccagtgctgtgcaaaagttttctggtacagcttcctccatt
atcgacgaaggattgggagaagtgggtactgtcaatgaaattgatagaagatccaccatt
ttaccaacagcagaagtggaaggtacgaaagctccagtagagaaggaggaagtaaaggtc
agtggcacagtttcaacaaactttccccaaactatagagccagccaaattatggtctagg
caagaagtcaaccctgtaagacaagaaattgaaagtgaaacaacatcagaggaacaaatt
caagaagaaaagtcatttgaatcccctcaaaactctcctgcaacagaacaaacaatcttt
gattcacagacatttactgaaactgaactcaaaaccacagattattctgtactaacaaca
aagaaaacttacagtgatgataaagaaatgaaggaggaagacacttctttagttaacatg
tctactccagatccagatgcaaatggcttggaatcttacacaactctccctgaagctact
gaaaagtcacattttttcttagctactgcattagtaactgaatctataccagctgaacat
gtagtcacagattcaccaatcaaaaaggaagaaagtacaaaacattttccgaaaggcatg
agaccaacaattcaagagtcagatactgagctcttattctctggactgggatcaggagaa
gaagttttacctactctaccaacagagtcagtgaattttactgaagtggaacaaatcaat
aacacattatatccccacacttctcaagtggaaagtacctcaagtgacaaaattgaagac
tttaacagaatggaaaatgtggcaaaagaagttggaccactcgtatctcaaacagacatc
tttgaaggtagtgggtcagtaaccagcacaacattaatagaaattttaagtgacactgga
gcagaaggacccacggtggcacctctccctttctccacggacatcggacatcctcaaaat
cagactgtcaggtgggcagaagaaatccagactagtagaccacaaaccataactgaacaa
gactctaacaagaattcttcaacagcagaaattaacgaaacaacaacctcatctactgat
tttctggctagagcttatggttttgaaatggccaaagaatttgttacatcagcaccaaaa
ccatctgacttgtattatgaaccttctggagaaggatctggagaagtggatattgttgat
tcatttcacacttctgcaactactcaggcaaccagacaagaaagcagcaccacatttgtt
tctgatgggtccctggaaaaacatcctgaggtgccaagcgctaaagctgttactgctgat
ggattcccaacagtttcagtgatgctgcctcttcattcagagcagaacaaaagctcccct
gatccaactagcacactgtcaaatacagtgtcatatgagaggtccacagacggtagtttc
caagaccgtttcagggaattcgaggattccaccttaaaacctaacagaaaaaaacccact
gaaaatattatcatagacctggacaaagaggacaaggatttaatattgacaattacagag
agtaccatccttgaaattctacctgagctgacatcggataaaaatactatcatagatatt
gatcatactaaacctgtgtatgaagacattcttggaatgcaaacagatatagatacagag
gtaccatcagaaccacatgacagtaatgatgaaagtaatgatgacagcactcaagttcaa
gagatctatgaggcagctgtcaacctttctttaactgaggaaacatttgagggctctgct
gatgttctggctagctacactcaggcaacacatgatgaatcaatgacttatgaagataga
agccaactagatcacatgggctttcacttcacaactgggatccctgctcctagcacagaa
acagaattagacgttttacttcccacggcaacatccctgccaattcctcgtaagtctgcc
acagttattccagagattgaaggaataaaagctgaagcaaaagccctggatgacatgttt
gaatcaagcactttgtctgatggtcaagctattgcagaccaaagtgaaataataccaaca
ttgggccaatttgaaaggactcaggaggagtatgaagacaaaaaacatgctggtccttct
tttcagccagaattctcttcaggagctgaggaggcattagtagaccatactccctatcta
agtattgctactacccaccttatggatcagagtgtaacagaggtgcctgatgtgatggaa
ggatccaatcccccatattacactgatacaacattagcagtttcaacatttgcgaagttg
tcttctcagacaccatcatctcccctcactatctactcaggcagtgaagcctctggacac
acagagatcccccagcccagtgctctgccaggaatagacgtcggctcatctgtaatgtcc
ccacaggattcttttaaggaaattcatgtaaatattgaagcgactttcaaaccatcaagt
gaggaataccttcacataactgagcctccctctttatctcctgacacaaaattagaacct
tcagaagatgatggtaaacctgagttattagaagaaatggaagcttctcccacagaactt
attgctgtggaaggaactgagattctccaagatttccaaaacaaaaccgatggtcaagtt
tctggagaagcaatcaagatgtttcccaccattaaaacacctgaggctggaactgttatt
acaactgccgatgaaattgaattagaaggtgctacacagtggccacactctacttctgct
tctgccacctatggggtcgaggcaggtgtggtgccttggctaagtccacagacttctgag
aggcccacgctttcttcttctccagaaataaaccctgaaactcaagcagctttaatcaga
gggcaggattccacgatagcagcatcagaacagcaagtggcagcgagaattcttgattcc
aatgatcaggcaacagtaaaccctgtggaatttaatactgaggttgcaacaccaccattt
tcccttctggagacttctaatgaaacagatttcctgattggcattaatgaagagtcagtg
gaaggcacggcaatctatttaccaggacctgatcgctgcaaaatgaacccgtgccttaac
ggaggcacctgttatcctactgaaacttcctacgtatgcacctgtgtgccaggatacagc
ggagaccagtgtgaacttgattttgatgaatgtcactctaatccctgtcgtaatggagcc
acttgtgttgatggttttaacacattcaggtgcctctgccttccaagttatgttggtgca
ctttgtgagcaagataccgagacatgtgactatggctggcacaaattccaagggcagtgc
tacaaatactttgcccatcgacgcacatgggatgcagctgaacgggaatgccgtctgcag
ggtgcccatctcacaagcatcctgtctcacgaagaacaaatgtttgttaatcgtgtgggc
catgattatcagtggataggcctcaatgacaagatgtttgagcatgacttccgttggact
gatggcagcacactgcaatacgagaattggagacccaaccagccagacagcttcttttct
gctggagaagactgtgttgtaatcatttggcatgagaatggccagtggaatgatgttccc
tgcaattaccatctcacctatacgtgcaagaaaggaacagtcgcttgcggccagccccct
gttgtagaaaatgccaagacctttggaaagatgaaacctcgttatgaaatcaactccctg
attagataccactgcaaagatggtttcattcaacgtcaccttccaactatccggtgctta
ggaaatggaagatgggctatacctaaaattacctgcatgaacccatctgcataccaaagg
acttattctatgaaatactttaaaaattcctcatcagcaaaggacaattcaataaataca
tccaaacatgatcatcgttggagccggaggtggcaggagtcgaggcgctga

DBGET integrated database retrieval system