KEGG   Homo sapiens (human): 146540
Entry
146540            CDS       T01001                                 

Gene name
ZNF785, ZNF688
Definition
(RefSeq) zinc finger protein 785
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    146540 (ZNF785)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    146540 (ZNF785)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    146540 (ZNF785)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 KRAB Zn-ribbon_8 zf-C2H2_jaz Zn_ribbon_SprT zf-C2H2_6 zf-C2H2_8 zf-DNA_Pol
Other DBs
NCBI-GeneID: 146540
NCBI-ProteinID: NP_689671
HGNC: 26496
Ensembl: ENSG00000197162
Vega: OTTHUMG00000176950
Pharos: A8K8V0(Tdark)
UniProt: A8K8V0 A0A024QZC7
Position
16p11.2
AA seq 405 aa
MGPPLAPRPAHVPGEAGPRRTRESRPGAVSFADVAVYFSPEEWECLRPAQRALYRDVMRE
TFGHLGALGFSVPKPAFISWVEGEVEAWSPEAQDPDGESSAAFSRGQGQEAGSRDGNEEK
ERLKKCPKQKEVAHEVAVKEWWPSVACPEFCNPRQSPMNPWLKDTLTRRLPHSCPDCGRN
FSYPSLLASHQRVHSGERPFSCGQCQARFSQRRYLLQHQFIHTGEKPYPCPDCGRRFRQR
GSLAIHRRAHTGEKPYACSDCKSRFTYPYLLAIHQRKHTGEKPYSCPDCSLRFAYTSLLA
IHRRIHTGEKPYPCPDCGRRFTYSSLLLSHRRIHSDSRPFPCVECGKGFKRKTALEAHRW
IHRSCSERRAWQQAVVGRSEPIPVLGGKDPPVHFRHFPDIFQECG
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggggccgcccctggcgccgcgcccggcccacgtacccggggaggccgggccccggagg
acgagggaaagcaggccgggcgccgtgagcttcgcggacgtggccgtgtacttctctccc
gaggagtgggaatgcctgcggccagcgcagagggccctgtaccgggacgtgatgcgggag
accttcggccacctgggcgcgctgggattttcagttcccaaacccgcttttatctcgtgg
gtggaaggagaagtggaggcgtggagcccggaggcccaggatcccgacggtgagagctct
gcagctttcagcaggggccaaggacaggaagcaggatccagggatgggaatgaggagaag
gaaaggctgaagaagtgtccaaaacaaaaagaggtggcgcatgaagtggctgtcaaggag
tggtggcccagcgtcgcctgcccagagttctgcaaccctaggcagagccccatgaatccc
tggctcaaggacactctgacccgaagactgccccactcttgcccagactgtggccgcaac
ttcagctacccttccctcctggccagccaccagcgggtccactccggggagcggcccttc
tcctgcggccagtgtcaggcgcgtttctcccagcgcaggtacctgctccagcatcagttc
atccacaccggcgagaagccctacccctgccccgactgcgggcgccgcttccgccagagg
ggttccctggctatccacaggcgggctcacaccggggagaagccttacgcgtgctcagac
tgcaagagtcgcttcacttacccctacctgctggccatccaccagcgcaagcacacgggc
gagaagccctacagctgccccgattgcagcctccgtttcgcctacacctccctgctggcc
atccacaggcgcatacacaccggcgagaagccctacccctgtcctgactgcggccgccgc
ttcacctattcttccctcctcctcagtcaccggcgcattcactccgacagccggcccttc
ccctgcgtggagtgtgggaaaggcttcaagcgcaagaccgccctggaagcccatcggtgg
atccaccgctcctgcagcgagaggcgcgcgtggcagcaggccgtggtggggcgttcagag
cccatccctgttttgggaggcaaggatcccccagttcacttccggcactttccagatata
tttcaagagtgtgggtga

DBGET integrated database retrieval system