KEGG   Homo sapiens (human): 147945Help
Entry
147945            CDS       T01001                                 

Gene name
NLRP4, CLR19.5, CT58, NALP4, PAN2, PYPAF4, RNH2
Definition
(RefSeq) NLR family pyrin domain containing 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    147945 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    147945 (NLRP4)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    147945 (NLRP4)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   147945 (NLRP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT PYRIN LRR_6 AAA_16 AAA_14 AAA_22 ResIII DAP3 AAA_25 VirE NTPase_1 RNA_helicase AAA_30
Motif
Other DBs
NCBI-GeneID: 147945
NCBI-ProteinID: NP_604393
OMIM: 609645
HGNC: 22943
Ensembl: ENSG00000160505
Vega: OTTHUMG00000181734
Pharos: Q96MN2(Tbio)
UniProt: Q96MN2 B2RCA1
Structure
PDB: 

Position
19q13.43
AA seq 994 aa AA seqDB search
MAASFFSDFGLMWYLEELKKEEFRKFKEHLKQMTLQLELKQIPWTEVKKASREELANLLI
KHYEEQQAWNITLRIFQKMDRKDLCMKVMRERTGYTKTYQAHAKQKFSRLWSSKSVTEIH
LYFEEEVKQEECDHLDRLFAPKEAGKQPRTVIIQGPQGIGKTTLLMKLMMAWSDNKIFRD
RFLYTFYFCCRELRELPPTSLADLISREWPDPAAPITEIVSQPERLLFVIDSFEELQGGL
NEPDSDLCGDLMEKRPVQVLLSSLLRKKMLPEASLLIAIKPVCPKELRDQVTISEIYQPR
GFNESDRLVYFCCFFKDPKRAMEAFNLVRESEQLFSICQIPLLCWILCTSLKQEMQKGKD
LALTCQSTTSVYSSFVFNLFTPEGAEGPTPQTQHQLKALCSLAAEGMWTDTFEFCEDDLR
RNGVVDADIPALLGTKILLKYGERESSYVFLHVCIQEFCAALFYLLKSHLDHPHPAVRCV
QELLVANFEKARRAHWIFLGCFLTGLLNKKEQEKLDAFFGFQLSQEIKQQIHQCLKSLGE
RGNPQGQVDSLAIFYCLFEMQDPAFVKQAVNLLQEANFHIIDNVDLVVSAYCLKYCSSLR
KLCFSVQNVFKKEDEHSSTSDYSLICWHHICSVLTTSGHLRELQVQDSTLSESTFVTWCN
QLRHPSCRLQKLGINNVSFSGQSVLLFEVLFYQPDLKYLSFTLTKLSRDDIRSLCDALNY
PAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTV
LVYLMLAFCHLSEQCCEYISEMLLRNKSVRYLDLSANVLKDEGLKTLCEALKHPDCCLDS
LCLVKCFITAAGCEDLASALISNQNLKILQIGCNEIGDVGVQLLCRALTHTDCRLEILGL
EECGLTSTCCKDLASVLTCSKTLQQLNLTLNTLDHTGVVVLCEALRHPECALQVLGLRKT
DFDEETQALLTAEEERNPNLTITDDCDTITRVEI
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctctttcttctctgattttggtcttatgtggtatctggaggagctcaaaaag
gaggagttcaggaaatttaaagaacatctcaagcaaatgactttgcagcttgaactcaag
cagattccctggactgaggtcaaaaaagcatcccgggaagaacttgcaaacctcttgatc
aagcactatgaagaacaacaagcttggaacataaccttaagaatctttcaaaagatggat
agaaaggatctctgcatgaaggtcatgagggagagaacaggatacacaaagacctatcaa
gctcacgcaaagcagaaattcagccgcttatggtccagcaagtctgtcactgagattcac
ctatactttgaggaggaagtcaagcaagaagaatgtgaccatttggaccgcctttttgct
cccaaggaagctgggaaacagccacgtacagtgatcattcaaggaccacaaggaattgga
aaaacgacactcctgatgaagctgatgatggcctggtcggacaacaagatctttcgggat
aggttcctgtacacgttctatttctgctgcagagaactgagggagttgccgccaacgagt
ttggctgacttgatttccagagagtggcctgaccccgctgctcctataacagagatcgtg
tctcaaccggagagactcttgttcgtcatcgacagcttcgaagagctgcagggcggcttg
aacgaacccgattcggatctgtgtggtgacttgatggagaaacggccggtgcaggtgctt
ctgagcagtttgctgaggaagaagatgctcccggaggcctccctgctcatcgctatcaaa
cccgtgtgcccgaaggagctccgggatcaggtgacgatctcagaaatctaccagccccgg
ggattcaacgagagtgataggttagtgtatttctgctgtttcttcaaagacccgaaaaga
gccatggaagccttcaatcttgtaagagaaagtgaacagctgttttccatatgccaaatc
ccgctcctctgctggatcctgtgtaccagtctgaagcaagagatgcagaaaggaaaagac
ctggccctgacctgccagagcactacctctgtgtactcctctttcgtctttaacctgttc
acacctgagggtgccgagggcccgactccgcaaacccagcaccagctgaaggccctgtgc
tccctggctgcagagggtatgtggacagacacatttgagttttgtgaagacgacctccgg
agaaatggggttgttgacgctgacatccctgcgctgctgggcaccaagatacttctgaag
tacggggagcgtgagagctcctacgtgttcctccacgtgtgtatccaggagttctgtgcc
gccttgttctatttgctcaagagccaccttgatcatcctcacccagctgtgagatgtgta
caggaattgctagttgccaattttgaaaaagcaaggagagcacattggatttttttgggg
tgttttctaactggccttttaaataaaaaggaacaagaaaaactggatgcgttttttggc
ttccaactgtcccaagagataaagcagcaaattcaccagtgcctgaagagcttaggggag
cgtggcaatcctcagggacaggtggattccttggcgatattttactgtctctttgaaatg
caggatcctgcctttgtgaagcaggcagtgaacctcctccaagaagctaactttcatatt
attgacaacgtggacttggtggtttctgcctactgcttaaaatactgctccagcttgagg
aaactctgtttttccgttcaaaatgtctttaagaaagaggatgaacacagctctacgtcg
gattacagcctcatctgttggcatcacatctgctctgtgctcaccaccagcgggcacctc
agagagctccaggtgcaggacagcaccctcagcgagtcgacctttgtgacctggtgtaac
cagctgaggcatcccagctgtcgccttcagaagcttggaataaataacgtttccttttct
ggccagagtgttctgctctttgaggtgctcttttatcagccagacttgaaatacctgagc
ttcaccctcacgaaactctctcgtgatgacatcaggtccctctgtgatgccttgaactac
ccagcaggcaacgtcaaagagctagcgctggtaaattgtcacctctcacccattgattgt
gaagtccttgctggccttctaaccaacaacaagaagctgacgtatctgaatgtatcctgc
aaccagttagacacaggcgtgccccttttgtgtgaagccctgtgcagcccagacacggtc
ctggtatacctgatgttggctttctgccacctcagcgagcagtgctgcgaatacatctct
gaaatgcttctgcgtaacaagagcgtgcgctatctagacctcagtgccaatgtcctgaag
gacgaaggactgaaaactctctgcgaggccttgaaacatccggactgctgcctggattca
ctgtgtttggtaaaatgttttatcactgctgctggctgtgaagacctcgcctctgctctc
atcagcaatcaaaacctgaagattctgcaaattgggtgcaatgaaatcggagatgtgggt
gtgcagctgttgtgtcgggctctgacgcatacggattgccgcttagagattcttgggttg
gaagaatgtgggttaacgagcacctgctgtaaggatctcgcgtctgttctcacctgcagt
aagaccctgcagcagctcaacctgaccttgaacaccttggaccacacaggggtggttgta
ctctgtgaggccctgagacacccagagtgtgccctgcaggtgctcgggctgagaaaaact
gattttgatgaggaaacccaggcacttctgacggctgaggaagagagaaatcctaacctg
accatcacagacgactgtgacacaatcacaagggtagagatctga

DBGET integrated database retrieval system