KEGG   Homo sapiens (human): 153Help
Entry
153               CDS       T01001                                 

Gene name
ADRB1, ADRB1R, B1AR, BETA1AR, RHR
Definition
(RefSeq) adrenoceptor beta 1
  KO
K04141  adrenergic receptor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04540  Gap junction
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04970  Salivary secretion
hsa05414  Dilated cardiomyopathy (DCM)
Drug target
Acebutolol (DG00314): D00597 D02338
Adaprolol maleate: D02765
Alprenolol (DG00303): D01182 D07156
Alprenoxime hydrochloride: D02834
Amiodarone (DG00204): D00636 D02910
Amosulalol (DG01302): D01469 D07451
Arbutamine: D02976
Arotinolol (DG01303): D01830 D07465
Atenolol: D00235
Befunolol (DG01138): D01512 D07496
Beradilol monoethyl maleate: D09843
Betaxolol (DG00315): D00598 D07526
Bevantolol: D01369
Bisoprolol (DG00316): D00634 D02342
Bopindolol (DG00310): D01794 D07537
Bucumolol hydrochloride: D01492
Bufetolol hydrochloride: D01504
Bunitrolol hydrochloride: D01444
Bunolol hydrochloride: D03177
Bupranolol (DG00311): D01454 D07590
Butopamine: D03195
Carteolol (DG00308): D00599 D07624
Carvedilol (DG00321): D00255 D03415
Celiprolol (DG00317): D01741 D07660
Cetamolol hydrochloride: D03449
Cicloprolol hydrochloride: D03490
Cimaterol: D03502
Cloranolol: D07183
Denopamine: D02614
Dexpropranolol hydrochloride: D03729
Diacetolol hydrochloride: D03759
Dilevalol hydrochloride: D01906
Dipivefrine (DG01129): D01017 D02349
Dobutamine (DG00216): D00632 D03879 D03880 D03881
Docarpamine: D01903
Dronedarone (DG00207): D02537 D03914
Droxidopa: D01277
Epanolol: D06646
Ephedrine (DG00227): D00124 D01386 D04018
Epinephrine (DG00013): D00095 D00996 D02149
Epinephryl borate: D04026
Esmolol (DG00318): D00644 D07916
Etilefrine (DG00210): D01573 D07931
Exaprolol hydrochloride: D04120
Flestolol sulfate: D04190
Indenolol (DG01323): D01958 D08078
Isoprenaline (DG00211): D01390 D02066 D02150 D08090
Labetalol (DG00320): D00600 D08106
Landiolol: D01847
Levdobutamine lactobionate: D04708
Levobetaxolol hydrochloride: D04710
Levobunolol (DG01136): D01025 D08115
Medroxalol (DG01317): D04888 D04889
Mepindolol: D07181
Methylephedrine (DG01229): D01952 D02109 D08206 D09842
Metipranolol (DG01137): D02081 D02374
Metoprolol (DG00313): D00601 D00635 D02358 D05011
Nadolol: D00432
Nebivolol (DG00319): D05127 D06622
Nipradilol: D01691
Norepinephrine (DG00212): D00076 D05206 D08284 D09794
Octodrine: D05228
Oxprenolol (DG00304): D01806 D08318
Pamatolol sulfate: D05345
Penbutolol (DG00312): D00602 D08074
Phenylpropanolamine (DG01041): D01224 D05466 D08368
Pindolol: D00513
Practolol: D05587
Primidolol: D02389
Propranolol (DG00305): D00483 D08443
Pseudoephedrine (DG01042): D00485 D05648 D05649 D08449
Racephedrine Hydrochloride: D08982
Racepinephrine (DG01444): D05688 D05689
S-atenolol: D01471
Sotalol (DG00307): D01026 D08525
Talinolol: D07184
Tazolol hydrochloride: D06014
Tertatolol (DG00309): D07182 D08572
Tilisolol (DG01322): D01795 D08598
Timolol (DG00306): D00378 D00603 D08600
Tiprenolol hydrochloride: D06162
Tolamolol: D06176
Xamoterol (DG00231): D06328 D06329
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    153 (ADRB1)
   04024 cAMP signaling pathway
    153 (ADRB1)
   04022 cGMP-PKG signaling pathway
    153 (ADRB1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    153 (ADRB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    153 (ADRB1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    153 (ADRB1)
   04924 Renin secretion
    153 (ADRB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    153 (ADRB1)
  09154 Digestive system
   04970 Salivary secretion
    153 (ADRB1)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    153 (ADRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    153 (ADRB1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    153 (ADRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 153
NCBI-ProteinID: NP_000675
OMIM: 109630
HGNC: 285
Ensembl: ENSG00000043591
Vega: OTTHUMG00000019079
Pharos: P08588(Tclin)
UniProt: P08588
Position
10q25.3
AA seq 477 aa AA seqDB search
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQGLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgggggtgctcgtcctgggcgcctccgagcccggtaacctgtcgtcggccgca
ccgctccccgacggcgcggccaccgcggcgcggctgctggtgcccgcgtcgccgcccgcc
tcgttgctgcctcccgccagcgaaagccccgagccgctgtctcagcagtggacagcgggc
atgggtctgctgatggcgctcatcgtgctgctcatcgtggcgggcaatgtgctggtgatc
gtggccatcgccaagacgccgcggctgcagacgctcaccaacctcttcatcatgtccctg
gccagcgccgacctggtcatggggctgctggtggtgccgttcggggccaccatcgtggtg
tggggccgctgggagtacggctccttcttctgcgagctgtggacctcagtggacgtgctg
tgcgtgacggccagcatcgagaccctgtgtgtcattgccctggaccgctacctcgccatc
acctcgcccttccgctaccagagcctgctgacgcgcgcgcgggcgcggggcctcgtgtgc
accgtgtgggccatctcggccctggtgtccttcctgcccatcctcatgcactggtggcgg
gcggagagcgacgaggcgcgccgctgctacaacgaccccaagtgctgcgacttcgtcacc
aaccgggcctacgccatcgcctcgtccgtagtctccttctacgtgcccctgtgcatcatg
gccttcgtgtacctgcgggtgttccgcgaggcccagaagcaggtgaagaagatcgacagc
tgcgagcgccgtttcctcggcggcccagcgcggccgccctcgccctcgccctcgcccgtc
cccgcgcccgcgccgccgcccggacccccgcgccccgccgccgccgccgccaccgccccg
ctggccaacgggcgtgcgggtaagcggcggccctcgcgcctcgtggccctgcgcgagcag
aaggcgctcaagacgctgggcatcatcatgggcgtcttcacgctctgctggctgcccttc
ttcctggccaacgtggtgaaggccttccaccgcgagctggtgcccgaccgcctcttcgtc
ttcttcaactggctgggctacgccaactcggccttcaaccccatcatctactgccgcagc
cccgacttccgcaaggccttccagggactgctctgctgcgcgcgcagggctgcccgccgg
cgccacgcgacccacggagaccggccgcgcgcctcgggctgtctggcccggcccggaccc
ccgccatcgcccggggccgcctcggacgacgacgacgacgatgtcgtcggggccacgccg
cccgcgcgcctgctggagccctgggccggctgcaacggcggggcggcggcggacagcgac
tcgagcctggacgagccgtgccgccccggcttcgcctcggaatccaaggtgtag

DBGET integrated database retrieval system