KEGG   Homo sapiens (human): 161823
Entry
161823            CDS       T01001                                 
Symbol
ADAL, HsMAPDA
Name
(RefSeq) adenosine deaminase like
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: A_deaminase Amidohydro_1
Other DBs
NCBI-GeneID: 161823
NCBI-ProteinID: NP_001311295
OMIM: 619346
HGNC: 31853
Ensembl: ENSG00000168803
Pharos: Q6DHV7(Tdark)
UniProt: Q6DHV7 A0A024R9S2
Position
15:43330351..43354569
AA seq 355 aa
MIEAEEQQPCKTDFYSELPKVELHAHLNGSISSHTMKKLIAQKPDLKIHDQMTVIDKGKK
RTLEECFQMFQTIHQLTSSPEDILMVTKDVIKEFADDGVKYLELRSTPRRENATGMTKKT
YVESILEGIKQSKQENLDIDVRYLIAVDRRGGPLVAKETVKLAEEFFLSTEGTVLGLDLS
GDPTVGQAKDFLEPLLEAKKAGLKLALHLSEIPNQKKETQILLDLLPDRIGHGTFLNSGE
GGSLDLVDFVRQHRIPLELCLTSNVKSQTVPSYDQHHFGFWYSIAHPSVICTDDKGVFAT
HLSQEYQLAAETFNLTQSQVWDLSYESINYIFASDSTRSELRKKWNHLKPRVLHI
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgatagaggcagaagagcaacagccttgcaagacagacttctattctgaattgccaaaa
gtggaacttcatgcccacttgaatggatccattagttctcataccatgaagaaattaata
gcccagaagccagatcttaaaatccacgatcagatgactgtgattgacaagggaaagaaa
agaactttggaagaatgtttccagatgtttcaaactattcatcagcttactagtagccct
gaagatattctaatggtcacaaaagatgtcataaaagaatttgcagatgacggcgtcaag
tacctggaactaaggagcacacccagaagagaaaatgctactggaatgactaaaaagact
tatgtggaatctatacttgaaggtataaaacagtccaaacaagaaaacttggacattgat
gttaggtatttgatagcagttgacagaagaggtggccctttagtagccaaggagactgta
aaacttgccgaggagttcttcctttctactgagggtacagttcttggccttgacctcagt
ggagaccctactgtaggacaagcaaaagacttcttggaacctcttttagaagctaagaaa
gcaggtctgaagttagcattgcatctttcagagattccaaaccaaaaaaaagaaacacaa
atactcctggatctgcttcctgacagaatcgggcatggaacatttctcaactccggtgag
ggaggatccctggatctggtggactttgtgaggcaacatcggataccactggaactctgt
ttgacctcaaacgtcaaaagtcagacagttccatcttatgaccagcaccatttcggattc
tggtacagcattgcccatccttctgtgatctgtactgatgataagggtgtttttgcaaca
cacctttctcaagagtaccagctggcagctgaaacatttaatttgacccagtctcaggtg
tgggatctgtcttatgaatccatcaactacatctttgcttctgacagcaccagatctgaa
ctgaggaagaaatggaatcacctgaagcccagagtgttacatatttaa

DBGET integrated database retrieval system