KEGG   Homo sapiens (human): 162514
Entry
162514            CDS       T01001                                 

Symbol
TRPV3, FNEPPK2, OLMS, OLMS1, VRL3
Name
(RefSeq) transient receptor potential cation channel subfamily V member 3
  KO
K04972  transient receptor potential cation channel subfamily V member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04750  Inflammatory mediator regulation of TRP channels
Disease
H02263  Focal nonepidermolytic palmoplantar keratoderma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    162514 (TRPV3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    162514 (TRPV3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   162514 (TRPV3)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank Ion_trans Ank_5 Ank_4 Pox_polyA_pol DUF4791 TSGP1
Other DBs
NCBI-GeneID: 162514
NCBI-ProteinID: NP_659505
OMIM: 607066
HGNC: 18084
Ensembl: ENSG00000167723
Vega: OTTHUMG00000090695
Pharos: Q8NET8(Tchem)
UniProt: Q8NET8
Structure
PDB: 

Position
17p13.2
AA seq 790 aa
MKAHPKEMVPLMGKRVAAPSGNPAILPEKRPAEITPTKKSAHFFLEIEGFEPNPTVAKTS
PPVFSKPMDSNIRQCISGNCDDMDSPQSPQDDVTETPSNPNSPSAQLAKEEQRRKKRRLK
KRIFAAVSEGCVEELVELLVELQELCRRRHDEDVPDFLMHKLTASDTGKTCLMKALLNIN
PNTKEIVRILLAFAEENDILGRFINAEYTEEAYEGQTALNIAIERRQGDIAALLIAAGAD
VNAHAKGAFFNPKYQHEGFYFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNIL
HALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETTRNNDGLTPLQLAAKMGKAEILKYI
LSREIKEKRLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDNSVLEITVYNTNIDNRHEML
TLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMG
WLQLLGRMFVLIWAMCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFIQAVLVILSVFLY
LFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFLLG
FGVALASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSKYPILFLFLLIT
YVILTFVLLLNMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGEL
CKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFE
EVEEFPETSV
NT seq 2373 nt   +upstreamnt  +downstreamnt
atgaaagcccaccccaaggagatggtgcctctcatgggcaagagagttgctgcccccagt
gggaaccctgccatcctgccagagaagaggccggcggagatcacccccacaaagaagagt
gcacacttcttcctggagatagaagggtttgaacccaaccccacagttgccaagacctct
cctcctgtcttctccaagcccatggattccaacatccggcagtgcatctctggtaactgt
gatgacatggactccccccagtctcctcaggatgatgtgacagagaccccatccaatccc
aacagccccagtgcacagctggccaaggaagagcagaggaggaaaaagaggcggctgaag
aagcgcatctttgcagccgtgtctgagggctgcgtggaggagttggtagagttgctggtg
gagctgcaggagctttgcaggcggcgccatgatgaggatgtgcctgacttcctcatgcac
aagctgacggcctccgacacggggaagacctgcctgatgaaggccttgttaaacatcaac
cccaacaccaaggagatagtgcggatcctgcttgcctttgctgaagagaacgacatcctg
ggcaggttcatcaacgccgagtacacagaggaggcctatgaagggcagacggcgctgaac
atcgccatcgagcggcggcagggggacatcgcagccctgctcatcgccgccggcgccgac
gtcaacgcgcacgccaagggggccttcttcaaccccaagtaccaacacgaaggcttctac
ttcggtgagacgcccctggccctggcagcatgcaccaaccagcccgagattgtgcagctg
ctgatggagcacgagcagacggacatcacctcgcgggactcacgaggcaacaacatcctt
cacgccctggtgaccgtggccgaggacttcaagacgcagaatgactttgtgaagcgcatg
tacgacatgatcctactgcggagtggcaactgggagctggagaccactcgcaacaacgat
ggcctcacgccgctgcagctggccgccaagatgggcaaggcggagatcctgaagtacatc
ctcagtcgtgagatcaaggagaagcggctccggagcctgtccaggaagttcaccgactgg
gcgtacggacccgtgtcatcctccctctacgacctcaccaacgtggacaccaccacggac
aactcagtgctggaaatcactgtctacaacaccaacatcgacaaccggcatgagatgctg
accctggagccgctgcacacgctgctgcatatgaagtggaagaagtttgccaagcacatg
ttctttctgtccttctgcttttatttcttctacaacatcaccctgaccctcgtctcgtac
taccgcccccgggaggaggaggccatcccgcaccccttggccctgacgcacaagatgggg
tggctgcagctcctagggaggatgtttgtgctcatctgggccatgtgcatctctgtgaaa
gagggcattgccatcttcctgctgagaccctcggatctgcagtccatcctctcggatgcc
tggttccactttgtcttttttatccaagctgtgcttgtgatactgtctgtcttcttgtac
ttgtttgcctacaaagagtacctcgcctgcctcgtgctggccatggccctgggctgggcg
aacatgctctactatacgcggggtttccagtccatgggcatgtacagcgtcatgatccag
aaggtcattttgcatgatgttctgaagttcttgtttgtatatatcgtgtttttgcttgga
tttggagtagccttggcctcgctgatcgagaagtgtcccaaagacaacaaggactgcagc
tcctacggcagcttcagcgacgcagtgctggaactcttcaagctcaccataggcctgggt
gacctgaacatccagcagaactccaagtatcccattctctttctgttcctgctcatcacc
tatgtcatcctcacctttgttctcctcctcaacatgctcattgctctgatgggcgagact
gtggagaacgtctccaaggagagcgaacgcatctggcgcctgcagagagccaggaccatc
ttggagtttgagaaaatgttaccagaatggctgaggagcagattccggatgggagagctg
tgcaaagtggccgaggatgatttccgactgtgtttgcggatcaatgaggtgaagtggact
gaatggaagacgcacgtctccttccttaacgaagacccggggcctgtaagacgaacagat
ttcaacaaaatccaagattcttccaggaacaacagcaaaaccactctcaatgcatttgaa
gaagtcgaggaattcccggaaacctcggtgtag

DBGET integrated database retrieval system