KEGG   Homo sapiens (human): 163059
Entry
163059            CDS       T01001                                 
Symbol
ZNF433
Name
(RefSeq) zinc finger protein 433
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    163059 (ZNF433)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    163059 (ZNF433)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    163059 (ZNF433)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf-C2H2_6 Zn_ribbon_SprT zf_UBZ zf-met zf-C2H2_11 zf-MYST zf-C2HC_2 DUF3268
Other DBs
NCBI-GeneID: 163059
NCBI-ProteinID: NP_001073880
HGNC: 20811
Ensembl: ENSG00000197647
UniProt: Q8N7K0
Position
19:complement(12014715..12035679)
AA seq 673 aa
MMFQDSVAFEDVAVTFTQEEWALLDPSQKNLCRDVMQETFRNLASIGKKWKPQNIYVEYE
NLRRNLRIVGERLFESKEGHQHGEILTQVPDDMLKKTTTGVKSCESSVYGEVGSAHSSLN
RHIRDDTGHKAYEYQEYGQKPYKCKYCKKPFNCLSSVQTHERAHSGRKLYVCEECGKTFI
SHSNLQRHRIMHRGDGPYKCKFCGKALMFLSLYLIHKRTHTGEKPYQCKQCGKAFSHSSS
LRIHERTHTGEKPYKCNECGKAFHSSTCLHAHKRTHTGEKPYECKQCGKAFSSSHSFQIH
ERTHTGEKPYECKECGKAFKCPSSVRRHERTHSRKKPYECKHCGKVLSYLTSFQNHLGMH
TGEISHKCKICGKAFYSPSSLQTHEKTHTGEKPYKCNQCGKAFNSSSSFRYHERTHTGEK
PYECKQCGKAFRSASLLQTHGRTHTGEKPYACKECGKPFSNFSFFQIHERMHREEKPYEC
KGYGKTFSLPSLFHRHERTHTGGKTYECKQCGRSFNCSSSFRYHGRTHTGEKPYECKQCG
KAFRSASQLQIHGRTHTGEKPYECKQCGKAFGSASHLQMHGRTHTGEKPYECKQCGKSFG
CASRLQMHGRTHTGEKPYKCKQCGKAFGCPSNLRRHGRTHTGEKPYKCNQCGKVFRCSSQ
LQVHGRAHCIDTP
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgatgtttcaggattcagtggcctttgaggatgtggctgtgaccttcacccaagaggag
tgggctttgctggatccttcccagaaaaatctctgtagagatgtgatgcaagaaaccttc
aggaacctggcctctatagggaaaaaatggaaaccccagaacatatatgtagagtacgaa
aatctaaggagaaacctaagaattgtgggagagagactctttgaaagtaaagaaggtcat
cagcatggagaaattttgacccaggttccagatgacatgctgaagaaaacaactactgga
gtaaaatcatgcgaaagcagtgtgtatggagaagtaggcagtgctcattcatctcttaat
aggcacatcagagatgacactggacacaaggcatatgagtatcaagaatatggacagaaa
ccatataaatgtaaatactgtaaaaaacctttcaactgtctctcctctgttcagacacat
gaaagggctcatagtggaaggaaactctatgtttgtgaggaatgcggaaaaacatttatt
tcccattcaaaccttcaaagacacaggataatgcaccgtggagatggaccttataagtgt
aaattttgtgggaaagccttgatgtttctcagtttgtatcttatccacaaacgaactcac
actggagagaaaccatatcaatgtaaacagtgtggtaaagcctttagtcattctagtagc
cttcgaatacatgaaagaactcacactggggagaagccttataaatgtaatgaatgtggg
aaagcattccatagttccacatgccttcatgctcataaaagaactcacactggggagaag
ccatatgaatgtaaacagtgtgggaaagccttcagctcttcccattcctttcaaatacat
gaaagaactcacacgggggagaagccatatgaatgtaaggaatgtggaaaagcattcaag
tgtcccagttctgttcgcagacatgaaagaacccactctaggaaaaaaccctatgaatgt
aaacattgtgggaaagtattatcttatcttaccagctttcaaaaccacttgggaatgcac
actggagagatatctcataaatgtaagatatgtgggaaagccttttattctcccagttca
cttcaaacacatgaaaaaactcacactggagagaaaccctataaatgcaaccaatgtggt
aaagcctttaattcttccagttccttccgatatcatgaaagaactcacactggagagaaa
ccttacgagtgtaagcaatgtgggaaagccttcagatctgcctcactccttcaaacacat
ggtaggactcacacgggagagaaaccctatgcatgtaaggaatgtggaaaaccatttagt
aatttctctttctttcaaatacatgaaaggatgcacagagaagagaagccgtatgaatgt
aagggttatgggaaaacattcagtttgcccagtttatttcatagacatgaaaggactcac
actggaggaaaaacctatgaatgcaagcagtgtggcagatccttcaactgttcgagctcc
tttcgatatcatggaaggactcacactggagagaaaccctatgaatgcaagcaatgtgga
aaagccttcagatctgcctcacagcttcaaattcatggaaggactcacactggagagaaa
ccttatgaatgtaagcagtgtgggaaagcctttggatctgcctcacaccttcaaatgcat
ggaaggactcacactggagagaaaccctatgaatgtaagcagtgtgggaagtcttttgga
tgtgcctcgcgacttcaaatgcatggaaggactcacactggagagaaaccgtataaatgt
aagcaatgtgggaaagcttttggatgtccctcaaaccttcgaaggcatggaaggactcac
actggagagaaaccctataaatgtaaccaatgtggtaaagtctttagatgttcttcacaa
cttcaagtgcatggaagggctcactgcatagacaccccataa

DBGET integrated database retrieval system