KEGG   Homo sapiens (human): 1646
Entry
1646              CDS       T01001                                 

Gene name
AKR1C2, AKR1C-pseudo, BABP, DD, DD-2, DD/BABP, DD2, DDH2, HAKRD, HBAB, MCDR2, SRXY8, TDD
Definition
(RefSeq) aldo-keto reductase family 1 member C2
  KO
K00089  3alpha-hydroxysteroid 3-dehydrogenase [EC:1.1.1.213 1.1.1.357]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa05204  Chemical carcinogenesis
Disease
H00607  46,XY gonadal dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1646 (AKR1C2)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    1646 (AKR1C2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     1646 (AKR1C2)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     1646 (AKR1C2)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 1646
NCBI-ProteinID: NP_001345
OMIM: 600450
HGNC: 385
Ensembl: ENSG00000151632
Vega: OTTHUMG00000017584
Pharos: P52895(Tchem)
UniProt: P52895
Structure
PDB: 

Position
10p15.1
AA seq 323 aa
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY
NT seq 972 nt   +upstreamnt  +downstreamnt
atggattcgaaataccagtgtgtgaagctgaatgatggtcacttcatgcctgtcctggga
tttggcacctatgcgcctgcagaggttcctaaaagtaaagctctagaggccgtcaaattg
gcaatagaagccgggttccaccatattgattctgcacatgtttacaataatgaggagcag
gttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattc
tacacttcaaagctttggagcaattcccatcgaccagagttggtccgaccagccttggaa
aggtcactgaaaaatcttcaattggactatgttgacctctatcttattcattttccagtg
tctgtaaagccaggtgaggaagtgatcccaaaagatgaaaatggaaaaatactatttgac
acagtggatctctgtgccacatgggaggccatggagaagtgtaaagatgcaggattggcc
aagtccatcggggtgtccaacttcaaccacaggctgctggagatgatcctcaacaagcca
gggctcaagtacaagcctgtctgcaaccaggtggaatgtcatccttacttcaaccagaga
aaactgctggatttctgcaagtcaaaagacattgttctggttgcctatagtgctctggga
tcccatcgagaagaaccatgggtggacccgaactccccggtgctcttggaggacccagtc
ctttgtgccttggcaaaaaagcacaagcgaaccccagccctgattgccctgcgctaccag
ctgcagcgtggggttgtggtcctggccaagagctacaatgagcagcgcatcagacagaac
gtgcaggtgtttgaattccagttgacttcagaggagatgaaagccatagatggcctaaac
agaaatgtgcgatatttgacccttgatatttttgctggcccccctaattatccattttct
gatgaatattaa

DBGET integrated database retrieval system