KEGG   Homo sapiens (human): 170959
Entry
170959            CDS       T01001                                 
Symbol
ZNF431, ZFP932
Name
(RefSeq) zinc finger protein 431
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    170959 (ZNF431)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    170959 (ZNF431)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    170959 (ZNF431)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz XPA_N Zn-ribbon_8 zf-C2H2_11 BolA zf-AN1 Rep_fac-A_C Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 170959
NCBI-ProteinID: NP_597730
OMIM: 619505
HGNC: 20809
Ensembl: ENSG00000196705
UniProt: Q8TF32
Position
19:21142040..21196053
AA seq 576 aa
MDDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWECLNPAQQNLY
MNVMLENYKNLVFLGVAVSKQDPVTCLEQEKEPWNMKRHEMVDEPPAMCSYFTKDLWPEQ
DIKDSFQQVILRRYGKCEHENLQLRKGSASVDEYKVHKEGYNELNQCLTTTQSKIFPCDK
YVKVFHKFLNANRHKTRHTGKKPFKCKKCGKSFCMLLHLSQHKRIHIRENSYQCEECGKA
FKWFSTLTRHKRIHTGEKPFKCEECGKAFKQSSTLTTHKIIHTGEKPYRCEECGKAFNRS
SHLTTHKIIHTGEKPYKCEECGKAFNQSSTLSTHKFIHAGEKPYKCEECDKAFNRFSYLT
KHKIIHTGEKSYKCEECGKGFNWSSTLTKHKRIHTGEKPYKCEVCGKAFNESSNLTTHKM
IHTGEKPYKCEECGKAFNRSPQLTAHKIIHTGEKPYKCEECGKAFSQSSILTTHKRIHTG
EKPYKCEECGKAFNRSSNLTKHKIIHTGEKSYKCEECGKAFNQSSTLTKHRKIHTRQKPY
NCEECDNTFNQSSNLIKQNNSYWRETLQMSRMWESL
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggacgacttgaaatatggagtgtatcctctcaaggaagcaagtggatgccctggggct
gagaggaatcttctagtttactcttattttgaaaaggagacattgacatttagggatgtg
gccatagaattctctctggaggagtgggaatgcctgaaccctgctcagcagaatttatat
atgaatgtgatgttagaaaactacaaaaacctggtcttcttgggtgttgctgtctctaag
caagacccagtcacctgtctggagcaagaaaaagagccctggaatatgaagagacatgag
atggtggatgaacccccagctatgtgttcttattttaccaaagacctttggccagagcaa
gacataaaagattcttttcaacaagtaatactgagaagatatggcaaatgtgaacatgag
aatttacagttaagaaaaggctccgcaagtgtagatgagtataaggtgcacaaagaaggt
tataatgagctaaaccagtgtttgacaactacccagagcaaaatatttccatgtgataaa
tatgtgaaagtctttcataaatttttaaatgcaaatagacataagacaagacatactgga
aagaaacctttcaaatgtaaaaaatgtggcaaatcattttgcatgcttttacacctaagt
caacataaaagaattcatattagagagaattcttaccaatgtgaagaatgtggcaaagct
tttaaatggttctcaacccttactagacacaagagaattcatactggagagaaacccttc
aaatgtgaagaatgtggcaaagcttttaagcagtcctcaacccttactacacataagata
attcatactggggagaaaccatatagatgtgaagaatgtggcaaagccttcaaccggtcc
tcacaccttactacacataagataattcatactggagagaagccctacaaatgtgaagaa
tgtggcaaagcttttaaccagtcttcaacccttagtacacataagttcattcatgctgga
gagaaaccctacaaatgtgaggaatgtgacaaagcttttaatcgattctcataccttact
aaacataagataattcatactggagaaaaatcttacaaatgtgaagaatgtggcaaaggc
tttaattggtcctcaacccttactaaacataaaagaattcatactggagagaaaccctac
aaatgtgaagtgtgtggcaaagcctttaatgagtcctcaaaccttactacacataagatg
attcatactggagagaaaccctacaaatgtgaagaatgtggcaaagcttttaaccggtcc
ccacaacttactgcacataagataattcatactggagagaaaccttacaaatgtgaagaa
tgtggcaaagcttttagccagtcatcaatccttactacacataagagaattcacactgga
gagaaaccctacaaatgtgaagaatgtggcaaagcttttaaccgatcctcaaatcttact
aaacataagataattcatacaggagagaaatcttacaaatgtgaagaatgtggtaaagcc
tttaaccaatcctcaactcttactaaacataggaaaattcatactagacagaaaccctac
aactgtgaagaatgtgacaatacatttaaccagtcctcaaaccttattaaacaaaataat
tcatactggagagaaactctacaaatgtcaagaatgtgggaaagcctttaa

DBGET integrated database retrieval system