KEGG   Homo sapiens (human): 1807Help
Entry
1807              CDS       T01001                                 

Gene name
DPYS, DHP, DHPase
Definition
(RefSeq) dihydropyrimidinase
  KO
K01464  dihydropyrimidinase [EC:3.5.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa00410  beta-Alanine metabolism
hsa00770  Pantothenate and CoA biosynthesis
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Module
hsa_M00046  Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Disease
H00199  Dihydropyrimidinase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    1807 (DPYS)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    1807 (DPYS)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    1807 (DPYS)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    1807 (DPYS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1807 (DPYS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.2  dihydropyrimidinase
     1807 (DPYS)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1807 (DPYS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 Amidohydro_2
Motif
Other DBs
NCBI-GeneID: 1807
NCBI-ProteinID: NP_001376
OMIM: 613326
HGNC: 3013
Ensembl: ENSG00000147647
Vega: OTTHUMG00000164891
Pharos: Q14117(Tbio)
UniProt: Q14117
Structure
PDB: 

Position
8q22.3
AA seq 519 aa AA seqDB search
MAAPSRLLIRGGRVVNDDFSEVADVLVEDGVVRALGHDLLPPGGAPAGLRVLDAAGKLVL
PGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIIDFAIPQKGGSLIEAFETWRSW
ADPKVCCDYSLHVAVTWWSDQVKEEMKILVQDKGVNSFKMFMAYKDLYMVTDLELYEAFS
RCKEIGAIAQVHAENGDLIAEGAKKMLALGITGPEGHELCRPEAVEAEATLRAITIASAV
NCPLYIVHVMSKSAAKVIADARRDGKVVYGEPIAASLGTDGTHYWNKEWHHAAHHVMGPP
LRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIW
EKGVHSGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSDADIVIWDPKGTRTISAKTHH
QAVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRD
RTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccctcgcggctcctgatccgcgggggtcgcgtggtcaacgatgacttctcg
gaggtggccgacgtgctggtggaggacggcgtggtgcgggcactcgggcacgacctgctg
cctcccgggggcgctcctgcggggctgcgggtcctcgacgccgccggcaagctcgtcctg
cccggaggcatcgacacacacacgcacatgcagttccccttcatgggctcgcggtccatc
gacgacttccaccagggcaccaaggctgctctctcaggaggcaccaccatgattattgat
ttcgccattcctcagaaaggtggctccctcattgaggccttcgagacctggcgaagctgg
gctgatcccaaagtttgctgcgactacagccttcatgtggcagtgacgtggtggagtgac
caggttaaagaagaaatgaaaatccttgtgcaagataaaggtgttaactctttcaagatg
tttatggcctataaagatctgtacatggtgacagacctggagctgtacgaagccttctct
cggtgcaaggaaattggagcaattgcccaggtccatgcggaaaatggagacttaattgca
gagggagcaaagaagatgttggctctggggataacaggccctgagggccacgagctgtgc
cgcccagaggcagtggaggcagaggccacgctgagagccatcaccatagccagcgctgtg
aactgtcctctctacattgtgcatgtgatgagcaagtctgcagctaaggtgatagcggat
gcaaggagagatgggaaggtggtctatggtgaacccatagcagccagtcttggcacagat
ggcactcactactggaataaagaatggcaccatgcagcccaccatgtcatgggtccacct
ttgcgaccagacccctcaacacccgacttcctcatgaatctgttggctaatgatgatcta
accacaacagggactgataactgcactttcaacacctgccagaaagctcttgggaaggat
gattttaccaagatccccaatggggtgaatggtgttgaagatcggatgtccgtaatatgg
gaaaaaggcgtgcatagtggtaaaatggatgaaaacagatttgtggcagttaccagcaca
aatgcagccaaaatttttaatctctatccaagaaaaggaagaatagctgtaggatcagat
gctgacattgttatttgggacccaaaaggcacaaggactatctcagcaaaaactcatcat
caggctgttaacttcaacattttcgagggcatggtttgccacggggtgccccttgtgact
atttcaagaggcaaagtggtatatgaagccggagtgttcagtgtcacggcaggagatggg
aagtttattcctcgaaaaccatttgctgaatatatttacaaacgaataaagcagcgagac
cggacttgcacacctacccctgtggagcgtgcaccctataagggagaagtcgccacactg
aaatccagagtgacaaaagaagatgccacagcagggaccaggaaacaggcccacccctga

DBGET integrated database retrieval system