KEGG   Homo sapiens (human): 1808Help
Entry
1808              CDS       T01001                                 

Gene name
DPYSL2, CRMP-2, CRMP2, DHPRP2, DRP-2, DRP2, N2A3, ULIP-2, ULIP2
Definition
(RefSeq) dihydropyrimidinase like 2
  KO
K07528  dihydropyrimidinase-like 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    1808 (DPYSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 1808
NCBI-ProteinID: NP_001377
OMIM: 602463
HGNC: 3014
Ensembl: ENSG00000092964
Vega: OTTHUMG00000099439
Pharos: Q16555(Tbio)
UniProt: Q16555
Structure
PDB: 

Position
8p21.2
AA seq 572 aa AA seqDB search
MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEA
HSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAF
DQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQ
IYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAI
TIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAA
FVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEE
RMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTI
SAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYK
RIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFS
LSGAQIDDNIPRRTTQRIVAPPGGRANITSLG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatcaggggaagaaaaatattccacgcatcacgagcgatcgtcttctgatcaaa
ggaggtaaaattgttaatgatgaccagtcgttctatgcagacatatacatggaagatggg
ttgatcaagcaaataggagaaaatctgattgtgccaggaggagtgaagaccatcgaggcc
cactcccggatggtgatccccggaggaattgacgtccacactcgtttccagatgcctgat
cagggaatgacgtctgctgatgatttcttccaaggaaccaaggcggccctggctggggga
accactatgatcattgaccacgttgttcctgagcctgggacaagcctgctcgctgccttt
gaccagtggagggaatgggccgacagcaagtcctgctgtgactactctctgcatgtggac
atcagtgagtggcataagggcatccaggaggagatggaagcgcttgtgaaggatcacggg
gtaaattccttcctcgtgtacatggctttcaaagatcgcttccagctaacggattgccag
atttatgaagtactgagtgtgatccgggatattggcgccatagcccaagtccacgcagaa
aatggcgacatcattgcagaggagcagcagaggatcctggatctgggcatcacgggcccc
gagggacatgtgctgagccgacctgaggaggtcgaggccgaagccgtgaatcgtgccatc
accatcgccaaccagaccaactgcccgctgtatatcaccaaggtgatgagcaaaagctct
gctgaggtcatcgcccaggcacggaagaagggaactgtggtgtatggcgagcccatcact
gccagcttgggaacggacggctcccattactggagcaagaactgggccaaggctgctgcc
tttgtcacctccccacccttgagccctgatccaaccactccagactttctcaactccttg
ctgtcctgtggagacctccaggtcacgggcagtgcccattgcacgtttaacactgcccag
aaggctgtaggaaaggacaacttcaccctgattccggagggcaccaatggcactgaggag
cggatgtccgtcatctgggacaaggctgtggtcactgggaagatggatgagaaccagttt
gtggctgtgaccagcaccaatgcagccaaagtcttcaacctttacccccggaaaggccgc
attgctgtgggatccgatgccgacctggtcatctgggaccccgacagcgttaaaaccatc
tctgccaagacacacaacagctctctcgagtacaacatctttgaaggcatggagtgccgc
ggctccccactggtggtcatcagccaggggaagattgtcctggaggacggcaccctgcat
gtcaccgaaggctctggacgctacattccccggaagcccttccctgattttgtttacaag
cgtatcaaggcaaggagcaggctggctgagctgagaggggttcctcgtggcctgtatgac
ggacctgtgtgtgaagtgtctgtgacgcccaagacagtcactccagcctcctcggccaag
acgtctcctgccaagcagcaggccccacctgtccggaacctgcaccagtctggattcagt
ttgtctggtgctcagattgatgacaacattccccgccgcaccacccagcgtatcgtggcg
ccccccggtggccgtgccaacatcaccagcctgggctag

DBGET integrated database retrieval system