KEGG   Homo sapiens (human): 1894
Entry
1894              CDS       T01001                                 

Gene name
ECT2, ARHGEF31
Definition
(RefSeq) epithelial cell transforming 2
  KO
K20704  protein ECT2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1894 (ECT2)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    1894 (ECT2)
SSDB
Motif
Pfam: RhoGEF PTCB-BRCT BRCT BRCT_2 LIG3_BRCT RTT107_BRCT_5 PGBA_C
Other DBs
NCBI-GeneID: 1894
NCBI-ProteinID: NP_001245244
OMIM: 600586
HGNC: 3155
Ensembl: ENSG00000114346
Vega: OTTHUMG00000156762
Pharos: Q9H8V3(Tbio)
UniProt: Q9H8V3
Structure
PDB: 
3L46 4N40

Position
3q26.31
AA seq 914 aa
MAENSVLTSTTGRTSLADSSIFDSKVTEISKENLLIGSTSYVEEEMPQIETRVILVQEAG
KQEELIKALKTIKIMEVPVIKIKESCPGKSDEKLIKSVINMDIKVGFVKMESVEEFEGLD
SPEFENVFVVTDFQDSVFNDLYKADCRVIGPPVVLNCSQKGEPLPFSCRPLYCTSMMNLV
LCFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANCTQGEKFRVAVSLGTPIMKP
EWIYKAWERRNEQDFYAAVDDFRNEFKVPPFQDCILSFLGFSDEEKTNMEEMTEMQGGKY
LPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDARAGETMYLYEKANTP
ELKKSVSMLSLNTPNSNRKRRRLKETLAQLSRETDVSPFPPRKRPSAEHSLSIGSLLDIS
NTPESSINYGDTPKSCTKSSKSSTPVPSKQSARWQVAKELYQTESNYVNILATIIQLFQV
PLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHTKIKDDLEDLIVNWDESKSIGDIFLKYS
KDLVKTYPPFVNFFEMSKETIIKCEKQKPRFHAFLKINQAKPECGRQSLVELLIRPVQRL
PSVALLLNDLKKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG
CPANLLSSHRSLVQRVETISLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPHGQ
TRPPASLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPPTEQANVLLSFQMTSDELPK
ENWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRA
FSFSKTPKRALRRALMTSHGSVEGRSPSSNDKHVMSRLSSTSSLAGIPSPSLVSLPSFFE
RRSHTLSRSTTHLI
NT seq 2745 nt   +upstreamnt  +downstreamnt
atggctgaaaatagtgtattaacatccactactgggaggactagcttggcagactcttcc
atttttgattctaaagttactgagatttccaaggaaaacttacttattggatctacttca
tatgtagaagaagagatgcctcagattgaaacaagagtgatattggttcaagaagctgga
aaacaagaagaacttataaaagccttaaagactattaaaataatggaagtccctgttata
aagataaaagaaagttgtcctggaaaatcggatgaaaaattaataaaaagtgttattaat
atggacattaaagtgggctttgtaaagatggagtcagtggaagaatttgaaggtttggat
tctccggaatttgaaaatgtatttgtagtcacggactttcaggattctgtctttaatgac
ctctacaaggctgattgtagagttattggaccaccagttgtattaaattgttcacaaaaa
ggagagcctttgccattttcatgtcgcccgttgtattgtacaagtatgatgaatctagta
ctatgctttactggatttaggaaaaaagaagaactagtcaggttggtgacattggtccat
cacatgggtggagttattcgaaaagactttaattcaaaagttacacatttggtggcaaat
tgtacacaaggagaaaaattcagggttgctgtgagtctaggtactccaattatgaagcca
gaatggatttataaagcttgggaaaggcggaatgaacaggatttctatgcagcagttgat
gactttagaaatgaatttaaagttcctccatttcaagattgtattttaagtttcctggga
ttttcagatgaagagaaaaccaatatggaagaaatgactgaaatgcaaggaggtaaatat
ttaccgcttggagatgaaagatgcactcaccttgtagttgaagagaatatagtaaaagat
cttccctttgaaccttcaaagaaactttatgttgtcaagcaagagtggttctggggaagc
attcaaatggatgcccgagctggagaaactatgtatttatatgaaaaggcaaatactcct
gagctcaagaaatcagtgtcaatgctttctctaaatacccctaacagcaatcgcaaacga
cgtcgtttaaaagaaacacttgctcagctttcaagagagacagacgtgtcaccatttcca
ccccgtaagcgcccatcagctgagcattccctttccatagggtcactcctagatatctcc
aacacaccagagtctagcattaactatggagacaccccaaagtcttgtactaagtcttct
aaaagctccactccagttccttcaaagcagtcagcaaggtggcaagttgcaaaagagctt
tatcaaactgaaagtaattatgttaatatattggcaacaattattcagttatttcaagta
ccattggaagaggaaggacaacgtggtggacctatccttgcaccagaggagattaagact
atttttggtagcatcccagatatctttgatgtacacactaagataaaggatgatcttgaa
gaccttatagttaattgggatgagagcaaaagcattggtgacatttttctgaaatattca
aaagatttggtaaaaacctaccctccctttgtaaacttctttgaaatgagcaaggaaaca
attattaaatgtgaaaaacagaaaccaagatttcatgcttttctcaagataaaccaagca
aaaccagaatgtggacggcagagccttgttgaacttcttatccgaccagtacagaggtta
cccagtgttgcattacttttaaatgatcttaagaagcatacagctgatgaaaatccagac
aaaagcactttagaaaaagctattggatcactgaaggaagtaatgacgcatattaatgag
gataagagaaaaacagaagctcaaaagcaaatttttgatgttgtttatgaagtagatgga
tgcccagctaatcttttatcttctcaccgaagcttagtacagcgggttgaaacaatttct
ctaggtgagcacccctgtgacagaggagaacaagtaactctcttcctcttcaatgattgc
ctagagatagcaagaaaacggcacaaggttattggcacttttaggagtcctcatggccaa
acccgacccccagcttctcttaagcatattcacctaatgcctctttctcagattaagaag
gtattggacataagagagacagaagattgccataatgcttttgccttgcttgtgaggcca
ccaacagagcaggcaaatgtgctactcagtttccagatgacatcagatgaacttccaaaa
gaaaactggctaaagatgctgtgtcgacatgtagctaacaccatttgtaaagcagatgct
gagaatcttatttatactgctgatccagaatcctttgaagtaaatacaaaagatatggac
agtacattgagtagagcatcaagagcaataaaaaagacttcaaaaaaggttacaagagca
ttctctttctccaaaactccaaaaagagctcttcgaagggctcttatgacatcccacggc
tcagtggagggaagaagtccttccagcaatgataagcatgtaatgagtcgtctttctagc
acatcatcattagcaggtatcccttctccctcccttgtcagccttccttccttctttgaa
aggagaagtcatacgttaagtagatctacaactcatttgatatga

DBGET integrated database retrieval system