KEGG   Homo sapiens (human): 1958Help
Entry
1958              CDS       T01001                                 

Gene name
EGR1, AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225
Definition
(RefSeq) early growth response 1
  KO
K09203  early growth response protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04371  Apelin signaling pathway
hsa04912  GnRH signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05020  Prion diseases
hsa05166  HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    1958 (EGR1)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    1958 (EGR1)
   04928 Parathyroid hormone synthesis, secretion and action
    1958 (EGR1)
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    1958 (EGR1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    1958 (EGR1)
  Infectious diseases
   05166 HTLV-I infection
    1958 (EGR1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    1958 (EGR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Cornifin zf-BED Zf_RING
Motif
Other DBs
NCBI-GeneID: 1958
NCBI-ProteinID: NP_001955
OMIM: 128990
HGNC: 3238
Ensembl: ENSG00000120738
Vega: OTTHUMG00000129197
Pharos: P18146(Tbio)
UniProt: P18146 Q546S1
Structure
PDB: 

Position
5q31.2
AA seq 543 aa AA seqDB search
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS
YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS
SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY
PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS
TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTI
EIC
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggccaaggccgagatgcagctgatgtccccgctgcagatctctgacccgttc
ggatcctttcctcactcgcccaccatggacaactaccctaagctggaggagatgatgctg
ctgagcaacggggctccccagttcctcggcgccgccggggccccagagggcagcggcagc
aacagcagcagcagcagcagcgggggcggtggaggcggcgggggcggcagcaacagcagc
agcagcagcagcaccttcaaccctcaggcggacacgggcgagcagccctacgagcacctg
accgcagagtcttttcctgacatctctctgaacaacgagaaggtgctggtggagaccagt
taccccagccaaaccactcgactgccccccatcacctatactggccgcttttccctggag
cctgcacccaacagtggcaacaccttgtggcccgagcccctcttcagcttggtcagtggc
ctagtgagcatgaccaacccaccggcctcctcgtcctcagcaccatctccagcggcctcc
tccgcctccgcctcccagagcccacccctgagctgcgcagtgccatccaacgacagcagt
cccatttactcagcggcacccaccttccccacgccgaacactgacattttccctgagcca
caaagccaggccttcccgggctcggcagggacagcgctccagtacccgcctcctgcctac
cctgccgccaagggtggcttccaggttcccatgatccccgactacctgtttccacagcag
cagggggatctgggcctgggcaccccagaccagaagcccttccagggcctggagagccgc
acccagcagccttcgctaacccctctgtctactattaaggcctttgccactcagtcgggc
tcccaggacctgaaggccctcaataccagctaccagtcccagctcatcaaacccagccgc
atgcgcaagtaccccaaccggcccagcaagacgcccccccacgaacgcccttacgcttgc
ccagtggagtcctgtgatcgccgcttctcccgctccgacgagctcacccgccacatccgc
atccacacaggccagaagcccttccagtgccgcatctgcatgcgcaacttcagccgcagc
gaccacctcaccacccacatccgcacccacacaggcgaaaagcccttcgcctgcgacatc
tgtggaagaaagtttgccaggagcgatgaacgcaagaggcataccaagatccacttgcgg
cagaaggacaagaaagcagacaaaagtgttgtggcctcttcggccacctcctctctctct
tcctacccgtccccggttgctacctcttacccgtccccggttactacctcttatccatcc
ccggccaccacctcatacccatcccctgtgcccacctccttctcctctcccggctcctcg
acctacccatcccctgtgcacagtggcttcccctccccgtcggtggccaccacgtactcc
tctgttccccctgctttcccggcccaggtcagcagcttcccttcctcagctgtcaccaac
tccttcagcgcctccacagggctttcggacatgacagcaaccttttctcccaggacaatt
gaaatttgctaa

DBGET integrated database retrieval system