KEGG   Homo sapiens (human): 1969
Entry
1969              CDS       T01001                                 

Symbol
EPHA2, ARCC2, CTPA, CTPP1, CTRCT6, ECK
Name
(RefSeq) EPH receptor A2
  KO
K05103  Eph receptor A2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
Disease
H01202  Cataract
Drug target
Dasatinib (DG00714): D03658 D06414<JP/US>
Sitravatinib (DG03045): D11140 D11541
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1969 (EPHA2)
   04014 Ras signaling pathway
    1969 (EPHA2)
   04015 Rap1 signaling pathway
    1969 (EPHA2)
   04151 PI3K-Akt signaling pathway
    1969 (EPHA2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1969 (EPHA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1969 (EPHA2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     1969 (EPHA2)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   1969 (EPHA2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Pur_ac_phosph_N Interfer-bind Ephrin_rec_like SKG6 Pkinase_fungal
Other DBs
NCBI-GeneID: 1969
NCBI-ProteinID: NP_004422
OMIM: 176946
HGNC: 3386
Ensembl: ENSG00000142627
Vega: OTTHUMG00000009527
Pharos: P29317(Tclin)
UniProt: P29317 A0A024QZA8
Structure
PDB: 

Position
1p36.13
AA seq 976 aa
MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI
VYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN
SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGG
VAVGVVLLLVLAGVGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQA
VLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDF
LGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGML
RGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIP
IRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSG
SEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAY
SLLGLKDQVNTVGIPI
NT seq 2931 nt   +upstreamnt  +downstreamnt
atggagctccaggcagcccgcgcctgcttcgccctgctgtggggctgtgcgctggccgcg
gccgcggcggcgcagggcaaggaagtggtactgctggactttgctgcagctggaggggag
ctcggctggctcacacacccgtatggcaaagggtgggacctgatgcagaacatcatgaat
gacatgccgatctacatgtactccgtgtgcaacgtgatgtctggcgaccaggacaactgg
ctccgcaccaactgggtgtaccgaggagaggctgagcgtatcttcattgagctcaagttt
actgtacgtgactgcaacagcttccctggtggcgccagctcctgcaaggagactttcaac
ctctactatgccgagtcggacctggactacggcaccaacttccagaagcgcctgttcacc
aagattgacaccattgcgcccgatgagatcaccgtcagcagcgacttcgaggcacgccac
gtgaagctgaacgtggaggagcgctccgtggggccgctcacccgcaaaggcttctacctg
gccttccaggatatcggtgcctgtgtggcgctgctctccgtccgtgtctactacaagaag
tgccccgagctgctgcagggcctggcccacttccctgagaccatcgccggctctgatgca
ccttccctggccactgtggccggcacctgtgtggaccatgccgtggtgccaccggggggt
gaagagccccgtatgcactgtgcagtggatggcgagtggctggtgcccattgggcagtgc
ctgtgccaggcaggctacgagaaggtggaggatgcctgccaggcctgctcgcctggattt
tttaagtttgaggcatctgagagcccctgcttggagtgccctgagcacacgctgccatcc
cctgagggtgccacctcctgcgagtgtgaggaaggcttcttccgggcacctcaggaccca
gcgtcgatgccttgcacacgacccccctccgccccacactacctcacagccgtgggcatg
ggtgccaaggtggagctgcgctggacgccccctcaggacagcgggggccgcgaggacatt
gtctacagcgtcacctgcgaacagtgctggcccgagtctggggaatgcgggccgtgtgag
gccagtgtgcgctactcggagcctcctcacggactgacccgcaccagtgtgacagtgagc
gacctggagccccacatgaactacaccttcaccgtggaggcccgcaatggcgtctcaggc
ctggtaaccagccgcagcttccgtactgccagtgtcagcatcaaccagacagagcccccc
aaggtgaggctggagggccgcagcaccacctcgcttagcgtctcctggagcatccccccg
ccgcagcagagccgagtgtggaagtacgaggtcacttaccgcaagaagggagactccaac
agctacaatgtgcgccgcaccgagggtttctccgtgaccctggacgacctggccccagac
accacctacctggtccaggtgcaggcactgacgcaggagggccagggggccggcagcaag
gtgcacgaattccagacgctgtccccggagggatctggcaacttggcggtgattggcggc
gtggctgtcggtgtggtcctgcttctggtgctggcaggagttggcttctttatccaccgc
aggaggaagaaccagcgtgcccgccagtccccggaggacgtttacttctccaagtcagaa
caactgaagcccctgaagacatacgtggacccccacacatatgaggaccccaaccaggct
gtgttgaagttcactaccgagatccatccatcctgtgtcactcggcagaaggtgatcgga
gcaggagagtttggggaggtgtacaagggcatgctgaagacatcctcggggaagaaggag
gtgccggtggccatcaagacgctgaaagccggctacacagagaagcagcgagtggacttc
ctcggcgaggccggcatcatgggccagttcagccaccacaacatcatccgcctagagggc
gtcatctccaaatacaagcccatgatgatcatcactgagtacatggagaatggggccctg
gacaagttccttcgggagaaggatggcgagttcagcgtgctgcagctggtgggcatgctg
cggggcatcgcagctggcatgaagtacctggccaacatgaactatgtgcaccgtgacctg
gctgcccgcaacatcctcgtcaacagcaacctggtctgcaaggtgtctgactttggcctg
tcccgcgtgctggaggacgaccccgaggccacctacaccaccagtggcggcaagatcccc
atccgctggaccgccccggaggccatttcctaccggaagttcacctctgccagcgacgtg
tggagctttggcattgtcatgtgggaggtgatgacctatggcgagcggccctactgggag
ttgtccaaccacgaggtgatgaaagccatcaatgatggcttccggctccccacacccatg
gactgcccctccgccatctaccagctcatgatgcagtgctggcagcaggagcgtgcccgc
cgccccaagttcgctgacatcgtcagcatcctggacaagctcattcgtgcccctgactcc
ctcaagaccctggctgactttgacccccgcgtgtctatccggctccccagcacgagcggc
tcggagggggtgcccttccgcacggtgtccgagtggctggagtccatcaagatgcagcag
tatacggagcacttcatggcggccggctacactgccatcgagaaggtggtgcagatgacc
aacgacgacatcaagaggattggggtgcggctgcccggccaccagaagcgcatcgcctac
agcctgctgggactcaaggaccaggtgaacactgtggggatccccatctga

KEGG   Homo sapiens (human): 2041
Entry
2041              CDS       T01001                                 

Symbol
EPHA1, EPH, EPHT, EPHT1
Name
(RefSeq) EPH receptor A1
  KO
K05102  Eph receptor A1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Drug target
Sitravatinib (DG03045): D11140 D11541
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    2041 (EPHA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2041 (EPHA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2041 (EPHA1)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2041 (EPHA1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Pur_ac_phosph_N Ephrin_rec_like Kdo Tissue_fac
Other DBs
NCBI-GeneID: 2041
NCBI-ProteinID: NP_005223
OMIM: 179610
HGNC: 3385
Ensembl: ENSG00000146904
Vega: OTTHUMG00000155894
Pharos: P21709(Tchem)
UniProt: P21709
Structure
PDB: 
3HIL 3KKA 2K1L 2K1K

Position
7q34-q35
AA seq 976 aa
MERRWPLGLGLVLLLCAPLPPGARAKEVTLMDTSKAQGELGWLLDPPKDGWSEQQQILNG
TPLYMYQDCPMQGRRDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKE
TFNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLVSGSVKLNVERCSLGRLTRRG
LYLAFHNPGACVALVSVRVFYQRCPETLNGLAQFPDTLPGPAGLVEVAGTCLPHARASPR
PSGAPRMHCSPDGEWLVPVGRCHCEPGYEEGGSGEACVACPSGSYRMDMDTPHCLTCPQQ
STAESEGATICTCESGHYRAPGEGPQVACTGPPSAPRNLSFSASGTQLSLRWEPPADTGG
RQDVRYSVRCSQCQGTAQDGGPCQPCGVGVHFSPGARGLTTPAVHVNGLEPYANYTFNVE
AQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLT
YELHVLNQDEERYQMVLEPRVLLTELQPDTTYIVRVRMLTPLGPGPFSPDHEFRTSPPVS
RGLTGGEIVAVIFGLLLGAALLLGILVFRSRRAQRQRQQRQRDRATDVDREDKLWLKPYV
DLQAYEDPAQGALDFTRELDPAWLMVDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTLKD
TSPGGQWWNFLREATIMGQFSHPHILHLEGVVTKRKPIMIITEFMENGALDAFLREREDQ
LVPGQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDFDGT
YETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIE
DGYRLPPPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQLLANPHSLRTIANFDPRM
TLRLPSLSGSDGIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITL
PGHQKRILCSIQGFKD
NT seq 2931 nt   +upstreamnt  +downstreamnt
atggagcggcgctggcccctggggctagggctggtgctgctgctctgcgccccgctgccc
ccgggggcgcgcgccaaggaagttactctgatggacacaagcaaggcacagggagagctg
ggctggctgctggatcccccaaaagatgggtggagtgaacagcaacagatactgaatggg
acacccctgtacatgtaccaggactgcccaatgcaaggacgcagagacactgaccactgg
cttcgctccaattggatctaccgcggggaggaggcttcccgcgtccacgtggagctgcag
ttcaccgtgcgggactgcaagagtttccctgggggagccgggcctctgggctgcaaggag
accttcaaccttctgtacatggagagtgaccaggatgtgggcattcagctccgacggccc
ttgttccagaaggtaaccacggtggctgcagaccagagcttcaccattcgagaccttgtg
tctggctccgtgaagctgaatgtggagcgctgctctctgggccgcctgacccgccgtggc
ctctacctcgctttccacaacccgggtgcctgtgtggccctggtgtctgtccgggtcttc
taccagcgctgtcctgagaccctgaatggcttggcccaattcccagacactctgcctggc
cccgctgggttggtggaagtggcggggacctgcttgccccacgcgcgggccagccccagg
ccctcaggtgcaccccgcatgcactgcagccctgatggcgagtggctggtgcctgtagga
cggtgccactgtgagcctggctatgaggaaggtggcagtggcgaagcatgtgttgcctgc
cctagcggctcctaccggatggacatggacacaccccattgtctcacgtgcccccagcag
agcactgctgagtctgagggggccaccatctgtacctgtgagagcggccattacagagct
cccggggagggcccccaggtggcatgcacaggtcccccctcggccccccgaaacctgagc
ttctctgcctcagggactcagctctccctgcgttgggaacccccagcagatacgggggga
cgccaggatgtcagatacagtgtgaggtgttcccagtgtcagggcacagcacaggacggg
gggccctgccagccctgtggggtgggcgtgcacttctcgccgggggcccgggggctcacc
acacctgcagtgcatgtcaatggccttgaaccttatgccaactacacctttaatgtggaa
gcccaaaatggagtgtcagggctgggcagctctggccatgccagcacctcagtcagcatc
agcatggggcatgcagagtcactgtcaggcctgtctctgagactggtgaagaaagaaccg
aggcaactagagctgacctgggcggggtcccggccccgaagccctggggcgaacctgacc
tatgagctgcacgtgctgaaccaggatgaagaacggtaccagatggttctagaacccagg
gtcttgctgacagagctgcagcctgacaccacatacatcgtcagagtccgaatgctgacc
ccactgggtcctggccctttctcccctgatcatgagtttcggaccagcccaccagtgtcc
aggggcctgactggaggagagattgtagccgtcatctttgggctgctgcttggtgcagcc
ttgctgcttgggattctcgttttccggtccaggagagcccagcggcagaggcagcagagg
cagcgtgaccgcgccaccgatgtggatcgagaggacaagctgtggctgaagccttatgtg
gacctccaggcatacgaggaccctgcacagggagccctggactttacccgggagcttgat
ccagcgtggctgatggtggacactgtcataggagaaggagagtttggggaagtgtatcga
gggaccctgaggctccccagccaggactgcaagactgtggccattaagaccttaaaagac
acatccccaggtggccagtggtggaacttccttcgagaggcaactatcatgggccagttt
agccacccgcatattctgcatctggaaggcgtcgtcacaaagcgaaagccgatcatgatc
atcacagaatttatggagaatggagccctggatgccttcctgagggagcgggaggaccag
ctggtccctgggcagctagtggccatgctgcagggcatagcatctggcatgaactacctc
agtaatcacaattatgtccaccgggacctggctgccagaaacatcttggtgaatcaaaac
ctgtgctgcaaggtgtctgactttggcctgactcgcctcctggatgactttgatggcaca
tacgaaacccagggaggaaagatccctatccgttggacagcccctgaagccattgcccat
cggatcttcaccacagccagcgatgtgtggagctttgggattgtgatgtgggaggtgctg
agctttggggacaagccttatggggagatgagcaatcaggaggttatgaagagcattgag
gatgggtaccggttgccccctcctgtggactgccctgcccctctgtatgagctcatgaag
aactgctgggcatatgaccgtgcccgccggccacacttccagaagcttcaggcacatctg
gagcaactgcttgccaacccccactccctgcggaccattgccaactttgaccccaggatg
actcttcgcctgcccagcctgagtggctcagatgggatcccatatcgaaccgtctctgag
tggctcgagtccatacgcatgaaacgctacatcctgcacttccactcggctgggctggac
accatggagtgtgtgctggagctgaccgctgaggacctgacgcagatgggaatcacactg
cccgggcaccagaagcgcattctttgcagtattcagggattcaaggactga

KEGG   Homo sapiens (human): 2042
Entry
2042              CDS       T01001                                 

Symbol
EPHA3, EK4, ETK, ETK1, HEK, HEK4, TYRO4
Name
(RefSeq) EPH receptor A3
  KO
K05104  Eph receptor A3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    2042 (EPHA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2042 (EPHA3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2042 (EPHA3)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2042 (EPHA3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_2 SAM_1 Pur_ac_phosph_N Ephrin_rec_like fn3_2 Kdo Pkinase_fungal SusE TMEM154
Other DBs
NCBI-GeneID: 2042
NCBI-ProteinID: NP_005224
OMIM: 179611
HGNC: 3387
Ensembl: ENSG00000044524
Vega: OTTHUMG00000159040
Pharos: P29320(Tchem)
UniProt: P29320 A0A140VJJ0 Q6P4R6
Structure
PDB: 

Position
3p11.1
AA seq 983 aa
MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDG
SMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFN
IICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSS
PPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESS
QVVMIAISAAVAIILLTVVIYVLIGRFCGYKSKHGADEKRLHFGNGHLKLPGLRTYVDPH
TYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYT
EKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTV
IQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYT
TRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEG
YRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSN
LLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVG
PQKKIISSIKALETQSKNGPVPV
NT seq 2952 nt   +upstreamnt  +downstreamnt
atggattgtcagctctccatcctcctccttctcagctgctctgttctcgacagcttcggg
gaactgattccgcagccttccaatgaagtcaatctactggattcaaaaacaattcaaggg
gagctgggctggatctcttatccatcacatgggtgggaagagatcagtggtgtggatgaa
cattacacacccatcaggacttaccaggtgtgcaatgtcatggaccacagtcaaaacaat
tggctgagaacaaactgggtccccaggaactcagctcagaagatttatgtggagctcaag
ttcactctacgagactgcaatagcattccattggttttaggaacttgcaaggagacattc
aacctgtactacatggagtctgatgatgatcatggggtgaaatttcgagagcatcagttt
acaaagattgacaccattgcagctgatgaaagtttcactcaaatggatcttggggaccgt
attctgaagctcaacactgagattagagaagtaggtcctgtcaacaagaagggattttat
ttggcatttcaagatgttggtgcttgtgttgccttggtgtctgtgagagtatacttcaaa
aagtgcccatttacagtgaagaatctggctatgtttccagacacggtacccatggactcc
cagtccctggtggaggttagagggtcttgtgtcaacaattctaaggaggaagatcctcca
aggatgtactgcagtacagaaggcgaatggcttgtacccattggcaagtgttcctgcaat
gctggctatgaagaaagaggttttatgtgccaagcttgtcgaccaggtttctacaaggca
ttggatggtaatatgaagtgtgctaagtgcccgcctcacagttctactcaggaagatggt
tcaatgaactgcaggtgtgagaataattacttccgggcagacaaagaccctccatccatg
gcttgtacccgacctccatcttcaccaagaaatgttatctctaatataaacgagacctca
gttatcctggactggagttggcccctggacacaggaggccggaaagatgttaccttcaac
atcatatgtaaaaaatgtgggtggaatataaaacagtgtgagccatgcagcccaaatgtc
cgcttcctccctcgacagtttggactcaccaacaccacggtgacagtgacagaccttctg
gcacatactaactacacctttgagattgatgccgttaatggggtgtcagagctgagctcc
ccaccaagacagtttgctgcggtcagcatcacaactaatcaggctgctccatcacctgtc
ctgacgattaagaaagatcggacctccagaaatagcatctctttgtcctggcaagaacct
gaacatcctaatgggatcatattggactacgaggtcaaatactatgaaaagcaggaacaa
gaaacaagttataccattctgagggcaagaggcacaaatgttaccatcagtagcctcaag
cctgacactatatacgtattccaaatccgagcccgaacagccgctggatatgggacgaac
agccgcaagtttgagtttgaaactagtccagactctttctccatctctggtgaaagtagc
caagtggtcatgatcgccatttcagcggcagtagcaattattctcctcactgttgtcatc
tatgttttgattgggaggttctgtggctataagtcaaaacatggggcagatgaaaaaaga
cttcattttggcaatgggcatttaaaacttccaggtctcaggacttatgttgacccacat
acatatgaagaccctacccaagctgttcatgagtttgccaaggaattggatgccaccaac
atatccattgataaagttgttggagcaggtgaatttggagaggtgtgcagtggtcgctta
aaacttccttcaaaaaaagagatttcagtggccattaagaccctgaaagttggctacaca
gaaaagcagaggagagacttcctgggagaagcaagcattatgggacagtttgaccacccc
aatatcattcgactggaaggagttgttaccaaaagtaagccagttatgattgtcacagaa
tacatggagaatggttccttggatagtttcctacgtaaacacgatgcccagtttactgtc
attcagctagtggggatgcttcgagggatagcatctggcatgaagtacctgtcagacatg
ggctatgttcaccgagacctcgctgctcggaacatcttgatcaacagtaacttggtgtgt
aaggtttctgatttcggactttcgcgtgtcctggaggatgacccagaagctgcttataca
acaagaggagggaagatcccaatcaggtggacatcaccagaagctatagcctaccgcaag
ttcacgtcagccagcgatgtatggagttatgggattgttctctgggaggtgatgtcttat
ggagagagaccatactgggagatgtccaatcaggatgtaattaaagctgtagatgagggc
tatcgactgccaccccccatggactgcccagctgccttgtatcagctgatgctggactgc
tggcagaaagacaggaacaacagacccaagtttgagcagattgttagtattctggacaag
cttatccggaatcccggcagcctgaagatcatcaccagtgcagccgcaaggccatcaaac
cttcttctggaccaaagcaatgtggatatcactaccttccgcacaacaggtgactggctt
aatggtgtctggacagcacactgcaaggaaatcttcacgggtgtggagtacagttcttgt
gacacaatagccaagatttccacagatgacatgaaaaaggttggtgtcaccgtggttggg
ccacagaagaagatcatcagtagcattaaagctctagaaacgcaatcaaagaatggccca
gttcccgtgtaa

KEGG   Homo sapiens (human): 2043
Entry
2043              CDS       T01001                                 

Symbol
EPHA4, EK8, HEK8, SEK, TYRO1
Name
(RefSeq) EPH receptor A4
  KO
K05105  Eph receptor A4 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    2043 (EPHA4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2043 (EPHA4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2043 (EPHA4)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2043 (EPHA4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_2 SAM_1 Ephrin_rec_like Pur_ac_phosph_N fn3_2 Kdo
Other DBs
NCBI-GeneID: 2043
NCBI-ProteinID: NP_001291465
OMIM: 602188
HGNC: 3388
Ensembl: ENSG00000116106
Vega: OTTHUMG00000133142
Pharos: P54764(Tchem)
UniProt: P54764 A1MA61
Structure
PDB: 

Position
2q36.1
AA seq 986 aa
MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEERSGECQACKIGYYKALSTDATCAKCPPHSYSV
WEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDI
SYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS
KYNPNPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRII
GDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPF
TYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYT
DKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTV
IQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYT
TRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNT
ALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAIT
HQNKILSSVQAMRTQMQQMHGRMVPV
NT seq 2961 nt   +upstreamnt  +downstreamnt
atggctgggattttctatttcgccctattttcgtgtctcttcgggatttgcgacgctgtc
acaggttccagggtataccccgcgaatgaagttaccttattggattccagatctgttcag
ggagaacttgggtggatagcaagccctctggaaggagggtgggaggaagtgagtatcatg
gatgaaaaaaatacaccaatccgaacctaccaagtgtgcaatgtgatggaacccagccag
aataactggctacgaactgattggatcacccgagaaggggctcagagggtgtatattgag
attaaattcaccttgagggactgcaatagtcttccgggcgtcatggggacttgcaaggag
acgtttaacctgtactactatgaatcagacaacgacaaagagcgtttcatcagagagaac
cagtttgtcaaaattgacaccattgctgctgatgagagcttcacccaagtggacattggt
gacagaatcatgaagctgaacaccgagatccgggatgtagggccattaagcaaaaagggg
ttttacctggcttttcaggatgtgggggcctgcatcgccctggtatcagtccgtgtgttc
tataaaaagtgtccactcacagtccgcaatctggcccagtttcctgacaccatcacaggg
gctgatacgtcttccctggtggaagttcgaggctcctgtgtcaacaactcagaagagaaa
gatgtgccaaaaatgtactgtggggcagatggtgaatggctggtacccattggcaactgc
ctatgcaacgctgggcatgaggagcggagcggagaatgccaagcttgcaaaattggatat
tacaaggctctctccacggatgccacctgtgccaagtgcccaccccacagctactctgtc
tgggaaggagccacctcgtgcacctgtgaccgaggctttttcagagctgacaacgatgct
gcctctatgccctgcacccgtccaccatctgctcccctgaacttgatttcaaatgtcaac
gagacatctgtgaacttggaatggagtagccctcagaatacaggtggccgccaggacatt
tcctataatgtggtatgcaagaaatgtggagctggtgaccccagcaagtgccgaccctgt
ggaagtggggtccactacaccccacagcagaatggcttgaagaccaccaaagtctccatc
actgacctcctagctcataccaattacacctttgaaatctgggctgtgaatggagtgtcc
aaatataaccctaacccagaccaatcagtttctgtcactgtgaccaccaaccaagcagca
ccatcatccattgctttggtccaggctaaagaagtcacaagatacagtgtggcactggct
tggctggaaccagatcggcccaatggggtaatcctggaatatgaagtcaagtattatgag
aaggatcagaatgagcgaagctatcgtatagttcggacagctgccaggaacacagatatc
aaaggcctgaaccctctcacttcctatgttttccacgtgcgagccaggacagcagctggc
tatggagacttcagtgagcccttggaggttacaaccaacacagtgccttcccggatcatt
ggagatggggctaactccacagtccttctggtctctgtctcgggcagtgtggtgctggtg
gtaattctcattgcagcttttgtcatcagccggagacggagtaaatacagtaaagccaaa
caagaagcggatgaagagaaacatttgaatcaaggtgtaagaacatatgtggaccccttt
acgtacgaagatcccaaccaagcagtgcgagagtttgccaaagaaattgacgcatcctgc
attaagattgaaaaagttataggagttggtgaatttggtgaggtatgcagtgggcgtctc
aaagtgcctggcaagagagagatctgtgtggctatcaagactctgaaagctggttataca
gacaaacagaggagagacttcctgagtgaggccagcatcatgggacagtttgaccatccg
aacatcattcacttggaaggcgtggtcactaaatgtaaaccagtaatgatcataacagag
tacatggagaatggctccttggatgcattcctcaggaaaaatgatggcagatttacagtc
attcagctggtgggcatgcttcgtggcattgggtctgggatgaagtatttatctgatatg
agctatgtgcatcgtgatctggccgcacggaacatcctggtgaacagcaacttggtctgc
aaagtgtctgattttggcatgtcccgagtgcttgaggatgatccggaagcagcttacacc
accaggggtggcaagattcctatccggtggactgcgccagaagcaattgcctatcgtaaa
ttcacatcagcaagtgatgtatggagctatggaatcgttatgtgggaagtgatgtcgtac
ggggagaggccctattgggatatgtccaatcaagatgtgattaaagccattgaggaaggc
tatcggttaccccctccaatggactgccccattgcgctccaccagctgatgctagactgc
tggcagaaggagaggagcgacaggcctaaatttgggcagattgtcaacatgttggacaaa
ctcatccgcaaccccaacagcttgaagaggacagggacggagagctccagacctaacact
gccttgttggatccaagctcccctgaattctctgctgtggtatcagtgggcgattggctc
caggccattaaaatggaccggtataaggataacttcacagctgctggttataccacacta
gaggctgtggtgcacgtgaaccaggaggacctggcaagaattggtatcacagccatcacg
caccagaataagattttgagcagtgtccaggcaatgcgaacccaaatgcagcagatgcac
ggcagaatggttcccgtctga

KEGG   Homo sapiens (human): 2044
Entry
2044              CDS       T01001                                 

Symbol
EPHA5, CEK7, EHK-1, EHK1, EK7, HEK7, TYRO4
Name
(RefSeq) EPH receptor A5
  KO
K05106  Eph receptor A5 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    2044 (EPHA5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2044 (EPHA5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2044 (EPHA5)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2044 (EPHA5)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Pur_ac_phosph_N Ephrin_rec_like HNH_5 DUF4998 Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 2044
NCBI-ProteinID: NP_004430
OMIM: 600004
HGNC: 3389
Ensembl: ENSG00000145242
Vega: OTTHUMG00000129273
Pharos: P54756(Tchem)
UniProt: P54756 B7ZKJ3 A0A384MU00 Q59FT4
Structure
PDB: 
2R2P 4ET7

Position
4q13.1-q13.2
AA seq 1037 aa
MRGSGPRGAGRRRPPSGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNE
VNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISN
EGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAAD
ESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRHL
AVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNG
TCQVCRPGFFKASPHIQSCGKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACTRPPSA
PRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGGHVRYLPRQSG
LKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKI
AKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQI
RARTAAGYGVFSRRFEFETTPVFAASSDQSQIPVIAVSVTVGVILLAVVIGVLLSGSCCE
CGCGRASSLCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPN
QAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRRD
FLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGM
LRGISAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKI
PIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSP
MDCPAALYQLMLDCWQKERNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHS
PLGSGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIM
NSLQEMKVQLVNGMVPL
NT seq 3114 nt   +upstreamnt  +downstreamnt
atgcggggctcggggccccggggtgcgggacgccggcggcccccaagcggcggcggcgac
acccccatcaccccagcgtccctggccggctgctactctgcacctcgacgggctcccctc
tggacgtgccttctcctgtgcgccgcactccggaccctcctggccagccccagcaacgaa
gtgaatttattggattcacgcactgtcatgggggacctgggatggattgcttttccaaaa
aatgggtgggaagagattggtgaagtggatgaaaattatgcccctatccacacataccaa
gtatgcaaagtgatggaacagaatcagaataactggcttttgaccagttggatctccaat
gaaggtgcttccagaatcttcatagaactcaaatttaccctgcgggactgcaacagcctt
cctggaggactggggacctgtaaggaaacctttaatatgtattactttgagtcagatgat
cagaatgggagaaacatcaaggaaaaccaatacatcaaaattgataccattgctgccgat
gaaagctttacagaacttgatcttggtgaccgtgttatgaaactgaatacagaggtcaga
gatgtaggacctctaagcaaaaagggattttatcttgcttttcaagatgttggtgcttgc
attgctctggtttctgtgcgtgtatactataaaaaatgcccttctgtggtacgacacttg
gctgtcttccctgacaccatcactggagctgattcttcccaattgctcgaagtgtcaggc
tcctgtgtcaaccattctgtgaccgatgaacctcccaaaatgcactgcagcgccgaaggg
gagtggctggtgcccatcgggaaatgcatgtgcaaggcaggatatgaagagaaaaatggc
acctgtcaagtgtgcagacctgggttcttcaaagcctcacctcacatccagagctgcggc
aaatgtccacctcacagttatacccatgaggaagcttcaacctcttgtgtctgtgaaaag
gattatttcaggagagagtctgatccacccacaatggcatgcacaagacccccctctgct
cctcggaatgccatctcaaatgttaatgaaactagtgtctttctggaatggattccgcct
gctgacactggtggaaggaaagacgtgtcatattatattgcatgcaagaagtgcaactcc
catgcaggtgtgtgtgaggagtgtggcggtcatgtcaggtaccttccccggcaaagcggc
ctgaaaaacacctctgtcatgatggtggatctactcgctcacacaaactatacctttgag
attgaggcagtgaatggagtgtccgacttgagcccaggagcccggcagtatgtgtctgta
aatgtaaccacaaatcaagcagctccatctccagtcaccaatgtgaaaaaagggaaaatt
gcaaaaaacagcatctctttgtcttggcaagaaccagatcgtcccaatggaatcatccta
gagtatgaaatcaagtattttgaaaaggaccaagagaccagctacacgattatcaaatct
aaagagacaactattactgcagagggcttgaaaccagcttcagtttatgtcttccaaatt
cgagcacgtacagcagcaggctatggtgtcttcagtcgaagatttgagtttgaaaccacc
ccagtgtttgcagcatccagcgatcaaagccagattcctgtaattgctgtgtctgtgaca
gtgggagtcattttgttggcagtggttatcggcgtcctcctcagtggaagttgctgcgaa
tgtggctgtgggagggcttcttccctgtgcgctgttgcccatccaagcctaatatggcgg
tgtggctacagcaaagcaaaacaagatccagaagaggaaaagatgcattttcataatggg
cacattaaactgccaggagtaagaacttacattgatccacatacctatgaggatcccaat
caagctgtccacgaatttgctaaggagatagaagcatcatgtatcaccattgagagagtt
attggagcaggtgaatttggtgaagtttgtagtggacgtttgaaactaccaggaaaaaga
gaattacctgtggctatcaaaacccttaaagtaggctatactgaaaagcaacgcagagat
ttcctaggtgaagcaagtatcatgggacagtttgatcatcctaacatcatccatttagaa
ggtgtggtgaccaaaagtaaaccagtgatgatcgtgacagagtatatggagaatggctct
ttagatacatttttgaagaaaaacgatgggcagttcactgtgattcagcttgttggcatg
ctgagaggtatctctgcaggaatgaagtacctttctgacatgggctatgtgcatagagat
cttgctgccagaaacatcttaatcaacagtaaccttgtgtgcaaagtgtctgactttgga
ctttcccgggtactggaagatgatcccgaggcagcctacaccacaaggggaggaaaaatt
ccaatcagatggactgccccagaagcaatagctttccgaaagtttacttctgccagtgat
gtctggagttatggaatagtaatgtgggaagttgtgtcttatggagagagaccctactgg
gagatgaccaatcaagatgtgattaaagcggtagaggaaggctatcgtctgccaagcccc
atggattgtcctgctgctctctatcagttaatgctggattgctggcagaaagagcgaaat
agcaggcccaagtttgatgaaatagtcaacatgttggacaagctgatacgtaacccaagt
agtctgaagacgctggttaatgcatcctgcagagtatctaatttattggcagaacatagc
ccactaggatctggggcctacagatcagtaggtgaatggctagaggcaatcaagatgggc
cggtatacagagattttcatggaaaatggatacagttcaatggacgctgtggctcaggtg
accttggaggatttgagacggcttggagtgactcttgtcggtcaccagaagaagatcatg
aacagccttcaagaaatgaaggtgcagctggtaaacggaatggtgccattgtaa

KEGG   Homo sapiens (human): 2045
Entry
2045              CDS       T01001                                 

Symbol
EPHA7, EHK-3, EHK3, EK11, HEK11
Name
(RefSeq) EPH receptor A7
  KO
K05108  EphA7 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    2045 (EPHA7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2045 (EPHA7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2045 (EPHA7)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2045 (EPHA7)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Ephrin_rec_like Pur_ac_phosph_N PTP_tm Tissue_fac Interfer-bind DUF4998 Y_Y_Y DUF2318 Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 2045
NCBI-ProteinID: NP_004431
OMIM: 602190
HGNC: 3390
Ensembl: ENSG00000135333
Vega: OTTHUMG00000015228
Pharos: Q15375(Tchem)
UniProt: Q15375
Structure
PDB: 
2REI 3DKO 3H8M 3NRU

Position
6q16.1
AA seq 998 aa
MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISG
LDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK
ETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKK
GFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE
EAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHS
FSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGR
NDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNG
VSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKY
YEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATG
KMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHF
KFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDV
AVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALD
AFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLS
RVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDM
SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSL
KTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTI
EDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV
NT seq 2997 nt   +upstreamnt  +downstreamnt
atggtttttcaaactcggtacccttcatggattattttatgctacatctggctgctccgc
tttgcacacacaggggaggcgcaggctgcgaaggaagtactactgctggattctaaagca
caacaaacagagttggagtggatttcctctccacccaatgggtgggaagaaattagtggt
ttggatgagaactataccccgatacgaacataccaggtgtgccaagtcatggagcccaac
caaaacaactggctgcggactaactggatttccaaaggcaatgcacaaaggatttttgta
gaattgaaattcaccctgagggattgtaacagtcttcctggagtactgggaacttgcaag
gaaacatttaatttgtactattatgaaacagactatgacactggcaggaatataagagaa
aacctctatgtaaaaatagacaccattgctgcagatgaaagttttacccaaggtgacctt
ggtgaaagaaagatgaagcttaacactgaggtgagagagattggacctttgtccaaaaag
ggattctatcttgcctttcaggatgtaggggcttgcatagctttggtttctgtcaaagtg
tactacaagaagtgctggtccattattgagaacttagctatctttccagatacagtgact
ggttcagaattttcctctttagtcgaggttcgagggacatgtgtcagcagtgcagaggaa
gaagcggaaaacgcccccaggatgcactgcagtgcagaaggagaatggttagtgcccatt
ggaaaatgtatctgcaaagcaggctaccagcaaaaaggagacacttgtgaaccctgtggc
cgtgggttctacaagtcttcctctcaagatcttcagtgctctcgttgtccaactcacagt
ttttctgataaagaaggctcctccagatgtgaatgtgaagatgggtattacagggctcca
tctgacccaccatacgttgcgtgcacaaggcctccatctgcaccacagaacctcattttc
aacatcaaccaaaccacagtaagtttggaatggagtcctcctgcagacaatgggggaaga
aacgatgtgacctacagaatattgtgtaagcggtgcagttgggagcagggcgaatgtgtt
ccctgtgggagtaacattggatacatgccccagcagactggattagaggataactatgtc
actgtcatggacctgctagcccacgctaattatacttttgaagttgaagctgtaaatgga
gtttctgacttaagccgatcccagaggctctttgctgctgtcagtatcaccactggtcaa
gcagctccctcgcaagtgagtggagtaatgaaggagagagtactgcagcggagtgtcgag
ctttcctggcaggaaccagagcatcccaatggagtcatcacagaatatgaaatcaagtat
tacgagaaagatcaaagggaacggacctactcaacagtaaaaaccaagtctacttcagcc
tccattaataatctgaaaccaggaacagtgtatgttttccagattcgggcttttactgct
gctggttatggaaattacagtcccagacttgatgttgctacactagaggaagctacaggt
aaaatgtttgaagctacagctgtctccagtgaacagaatcctgttattatcattgctgtg
gttgctgtagctgggaccatcattttggtgttcatggtctttggcttcatcattgggaga
aggcactgtggttatagcaaagctgaccaagaaggcgatgaagagctttactttcatttt
aaatttccaggcaccaaaacctacattgaccctgaaacctatgaggacccaaatagagct
gtccatcaattcgccaaggagctagatgcctcctgtattaaaattgagcgtgtgattggt
gcaggagaattcggtgaagtctgcagtggccgtttgaaacttccagggaaaagagatgtt
gcagtagccataaaaaccctgaaagttggttacacagaaaaacaaaggagagactttttg
tgtgaagcaagcatcatggggcagtttgaccacccgaatgttgtccatttggaaggggtt
gttacaagagggaaaccagtcatgatagtaatagagttcatggaaaatggagccctagat
gcatttctcaggaaacatgatgggcaatttacagtcattcagttagtaggaatgctgaga
ggaattgctgctggaatgagatatttggctgatatgggatatgttcacagggaccttgca
gctcgcaatattcttgtcaacagcaatctcgtttgtaaagtgtcagattttggcctgtcc
cgagttatagaggatgatccagaagctgtctatacaactactggtggaaaaattccagta
aggtggacagcacccgaagccatccagtaccggaaattcacatcagccagtgatgtatgg
agctatggaatagtcatgtgggaagttatgtcttatggagaaagaccttattgggacatg
tcaaatcaagatgttataaaagcaatagaagaaggttatcgtttaccagcacccatggac
tgcccagctggccttcaccagctaatgttggattgttggcaaaaggagcgtgctgaaagg
ccaaaatttgaacagatagttggaattctagacaaaatgattcgaaacccaaatagtctg
aaaactcccctgggaacttgtagtaggccaataagccctcttctggatcaaaacactcct
gatttcactaccttttgttcagttggagaatggctacaagctattaagatggaaagatat
aaagataatttcacggcagctggctacaattcccttgaatcagtagccaggatgactatt
gaggatgtgatgagtttagggatcacactggttggtcatcaaaagaaaatcatgagcagc
attcagactatgagagcacaaatgctacatttacatggaactggcattcaagtgtga

KEGG   Homo sapiens (human): 2046
Entry
2046              CDS       T01001                                 

Symbol
EPHA8, EEK, EK3, HEK3
Name
(RefSeq) EPH receptor A8
  KO
K05109  Eph receptor A8 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    2046 (EPHA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2046 (EPHA8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2046 (EPHA8)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2046 (EPHA8)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_1 SAM_2 EphA2_TM Pur_ac_phosph_N fn3_2 Kdo Ephrin_rec_like SusE Interfer-bind
Other DBs
NCBI-GeneID: 2046
NCBI-ProteinID: NP_065387
OMIM: 176945
HGNC: 3391
Ensembl: ENSG00000070886
Vega: OTTHUMG00000002892
Pharos: P29322(Tchem)
UniProt: P29322
Structure
PDB: 
3KUL 1X5L 1UCV

Position
1p36.12
AA seq 1005 aa
MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEV
DESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKE
TFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRG
FYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEER
DTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSA
APAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDI
TYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD
LSPEPRRAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEK
DKEMQSYSTLKAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDT
RTIVWICLTLITGLVVLLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHP
PGKLPEPQFYAEPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSGEVCYGRLRVPGQR
DVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGS
LDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCKVSDFG
LSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYW
NMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPE
SLRATATVSRCPPPAFVRSCFDLRGGSGGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSLG
MVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGPRRHL
NT seq 3018 nt   +upstreamnt  +downstreamnt
atggcccccgcccggggccgcctgccccctgcgctctgggtcgtcacggccgcggcggcg
gcggccacctgcgtgtccgcggcgcgcggcgaagtgaatttgctggacacgtcgaccatc
cacggggactggggctggctcacgtatccggctcatgggtgggactccatcaacgaggtg
gacgagtccttccagcccatccacacgtaccaggtttgcaacgtcatgagccccaaccag
aacaactggctgcgcacgagctgggtcccccgagacggcgcccggcgcgtctatgctgag
atcaagtttaccctgcgcgactgcaacagcatgcctggtgtgctgggcacctgcaaggag
accttcaacctctactacctggagtcggaccgcgacctgggggccagcacacaagaaagc
cagttcctcaaaatcgacaccattgcggccgacgagagcttcacaggtgccgaccttggt
gtgcggcgtctcaagctcaacacggaggtgcgcagtgtgggtcccctcagcaagcgcggc
ttctacctggccttccaggacataggtgcctgcctggccatcctctctctccgcatctac
tataagaagtgccctgccatggtgcgcaatctggctgccttctcggaggcagtgacgggg
gccgactcgtcctcactggtggaggtgaggggccagtgcgtgcggcactcagaggagcgg
gacacacccaagatgtactgcagcgcggagggcgagtggctcgtgcccatcggcaaatgc
gtgtgcagtgccggctacgaggagcggcgggatgcctgtgtggcctgtgagctgggcttc
tacaagtcagcccctggggaccagctgtgtgcccgctgccctccccacagccactccgca
gctccagccgcccaagcctgccactgtgacctcagctactaccgtgcagccctggacccg
ccgtcctcagcctgcacccggccaccctcggcaccagtgaacctgatctccagtgtgaat
gggacatcagtgactctggagtgggcccctcccctggacccaggtggccgcagtgacatc
acctacaatgccgtgtgccgccgctgcccctgggcactgagccgctgcgaggcatgtggg
agcggcacccgctttgtgccccagcagacaagcctggtgcaggccagcctgctggtggcc
aacctgctggcccacatgaactactccttctggatcgaggccgtcaatggcgtgtccgac
ctgagccccgagccccgccgggccgctgtggtcaacatcaccacgaaccaggcagccccg
tcccaggtggtggtgatccgtcaagagcgggcggggcagaccagcgtctcgctgctgtgg
caggagcccgagcagccgaacggcatcatcctggagtatgagatcaagtactacgagaag
gacaaggagatgcagagctactccaccctcaaggccgtcaccaccagagccaccgtctcc
ggcctcaagccgggcacccgctacgtgttccaggtccgagcccgcacctcagcaggctgt
ggccgcttcagccaggccatggaggtggagaccgggaaaccccggccccgctatgacacc
aggaccattgtctggatctgcctgacgctcatcacgggcctggtggtgcttctgctcctg
ctcatctgcaagaagaggcactgtggctacagcaaggccttccaggactcggacgaggag
aagatgcactatcagaatggacaggcacccccacctgtcttcctgcctctgcatcacccc
ccgggaaagctcccagagccccagttctatgcggaaccccacacctacgaggagccaggc
cgggcgggccgcagtttcactcgggagatcgaggcctctaggatccacatcgagaaaatc
atcggctctggagactccggggaagtctgctacgggaggctgcgggtgccagggcagcgg
gatgtgcccgtggccatcaaggccctcaaagccggctacacggagagacagaggcgggac
ttcctgagcgaggcgtccatcatggggcaattcgaccatcccaacatcatccgcctcgag
ggtgtcgtcacccgtggccgcctggcaatgattgtgactgagtacatggagaacggctct
ctggacaccttcctgaggacccacgacgggcagttcaccatcatgcagctggtgggcatg
ctgagaggagtgggtgccggcatgcgctacctctcagacctgggctatgtccaccgagac
ctggccgcccgcaacgtcctggttgacagcaacctggtctgcaaggtgtctgacttcggg
ctctcacgggtgctggaggacgacccggatgctgcctacaccaccacgggcgggaagatc
cccatccgctggacggccccagaggccatcgccttccgcaccttctcctcggccagcgac
gtgtggagcttcggcgtggtcatgtgggaggtgctggcctatggggagcggccctactgg
aacatgaccaaccgggatgtcatcagctctgtggaggaggggtaccgcctgcccgcaccc
atgggctgcccccacgccctgcaccagctcatgctcgactgttggcacaaggaccgggcg
cagcggcctcgcttctcccagattgtcagtgtcctcgatgcgctcatccgcagccctgag
agtctcagggccaccgccacagtcagcaggtgcccaccccctgccttcgtccggagctgc
tttgacctccgagggggcagcggtggcggtgggggcctcaccgtgggggactggctggac
tccatccgcatgggccggtaccgagaccacttcgctgcgggcggatactcctctctgggc
atggtgctacgcatgaacgcccaggacgtgcgcgccctgggcatcaccctcatgggccac
cagaagaagatcctgggcagcattcagaccatgcgggcccagctgaccagcacccagggg
ccccgccggcacctctga

KEGG   Homo sapiens (human): 285220
Entry
285220            CDS       T01001                                 

Symbol
EPHA6, EHK-2, EHK2, EK12, EPA6, HEK12, PRO57066
Name
(RefSeq) EPH receptor A6
  KO
K05107  Eph receptor A6 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    285220 (EPHA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    285220 (EPHA6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     285220 (EPHA6)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   285220 (EPHA6)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase EphA2_TM Kdo UPF0542 Pkinase_fungal
Other DBs
NCBI-GeneID: 285220
NCBI-ProteinID: NP_001265229
OMIM: 600066
HGNC: 19296
Ensembl: ENSG00000080224
Vega: OTTHUMG00000159208
Pharos: Q9UF33(Tchem)
UniProt: Q9UF33
Position
3q11.2
AA seq 398 aa
MKDSPFQVTKLYWLNEKWDFIASASDMAAEQGQILVIATAAVGGFTLLVILTLFFLITGR
CQWYIKAKMKSEEKRRNHLQNGHLRFPGIKTYIDPDTYEDPSLAVHEFAKEIDPSRIRIE
RVIGAGEFGEVCSGRLKTPGKREIPVAIKTLKGGHMDRQRRDFLREASIMGQFDHPNIIR
LEGVVTKRSFPAIGVEAFCPSFLRAGFLNSIQAPHPVPGGGSLPPRIPAGRPVMIVVEYM
ENGSLDSFLRKHDGHFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILVNSNLVCKV
SDFGLSRVLEDDPEAAYTTTRPTNHNKEQSELVKEDGLESLCEQCESSSGYGTGLVLMWK
RNRRAMGASGQTRKQCDKRDNPPTDLFQTLTLNLCYSA
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgaaagactctccatttcaagtgacaaaactgtactggcttaatgaaaagtgggacttt
attgcctcagcttctgacatggcagcagaacaaggacagattctcgtgatagccaccgcc
gctgttggcggattcactctcctcgtcatcctcactttattcttcttgatcactgggaga
tgtcagtggtacataaaagccaagatgaagtcagaagagaagagaagaaaccacttacag
aatgggcatttgcgcttcccgggaattaaaacttacattgatccagatacatatgaagac
ccatccctagcagtccatgaatttgcaaaggagattgatccctcaagaattcgtattgag
agagtcattggggcaggtgaatttggagaagtctgtagtgggcgtttgaagacaccaggg
aaaagagagatcccagttgccattaaaactttgaaaggtggccacatggatcggcaaaga
agagattttctaagagaagctagtatcatgggccagtttgaccatccaaacatcattcgc
ctagaaggggttgtcaccaaaagatccttcccggccattggggtggaggcgttttgcccc
agcttcctgagggcagggtttttaaatagcatccaggccccgcatccagtgccaggggga
ggatctttgccccccaggattcctgctggcagaccagtaatgattgtggtggaatatatg
gagaatggatccctagactcctttttgcggaagcatgatggccacttcacagtcatccag
ttggtcggaatgctccgaggcattgcatcaggcatgaagtatctttctgatatgggttat
gttcatcgagacctagcggctcggaatatactggtcaatagcaacttagtatgcaaagtt
tctgattttggtctctccagagtgctggaagatgatccagaagctgcttatacaacaact
agacccacaaatcacaacaaagagcaatcagaactggttaaagaagatggtctggaaagc
ttgtgtgagcagtgcgagtccagctctggttatggtactggactggtcctcatgtggaag
agaaacagaagggccatgggagccagtggccagaccagaaagcaatgtgacaagagagat
aaccctccaacagacctcttccaaactctaacacttaacctctgctattctgcataa

DBGET integrated database retrieval system