KEGG   Homo sapiens (human): 1990Help
Entry
1990              CDS       T01001                                 

Gene name
CELA1, ELA1
Definition
(RefSeq) chymotrypsin like elastase 1
  KO
K01326  pancreatic elastase I [EC:3.4.21.36]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1990 (CELA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.36  pancreatic elastase
     1990 (CELA1)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   1990 (CELA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 1990
NCBI-ProteinID: NP_001962
OMIM: 130120
HGNC: 3308
Ensembl: ENSG00000139610
Vega: OTTHUMG00000167523
Pharos: Q9UNI1(Tchem)
UniProt: Q9UNI1
Position
12q13.13
AA seq 258 aa AA seqDB search
MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMT
AAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQS
VTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSS
YWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTV
FTQVSAYISWINNVIASN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcctttatggacacagcacccaggaccttccggaaaccaatgcccgcgtagtc
ggagggactgaggccgggaggaattcctggccctctcagatttccctccagtaccggtct
ggaggttcccggtatcacacctgtggagggacccttatcagacagaactgggtgatgaca
gctgctcactgcgtggattaccagaagactttccgcgtggtggctggagaccataacctg
agccagaatgatggcactgagcagtacgtgagtgtgcagaagatcgtggtgcatccatac
tggaacagcgataacgtggctgccggctatgacatcgccctgctgcgcctggcccagagc
gttaccctcaatagctatgtccagctgggtgttctgccccaggagggagccatcctggct
aacaacagtccctgctacatcacaggctggggcaagaccaagaccaatgggcagctggcc
cagaccctgcagcaggcttacctgccctctgtggactacgccatctgctccagctcctcc
tactggggctccactgtgaagaacaccatggtgtgtgctggtggagatggagttcgctct
ggatgccagggtgactctgggggccccctccattgcttggtgaatggcaagtattctgtc
catggagtgaccagctttgtgtccagccggggctgtaatgtctccaggaagcctacagtc
ttcacccaggtctctgcttacatctcctggataaataatgtcatcgcctccaactga

DBGET integrated database retrieval system