KEGG   Homo sapiens (human): 202333
Entry
202333            CDS       T01001                                 
Symbol
CMYA5, C5orf10, SPRYD2, TRIM76
Name
(RefSeq) cardiomyopathy associated 5
  KO
K24480  cardiomyopathy-associated protein 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    202333 (CMYA5)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   202333 (CMYA5)
SSDB
Motif
Pfam: fn3 SPRY PRY
Other DBs
NCBI-GeneID: 202333
NCBI-ProteinID: NP_705838
OMIM: 612193
HGNC: 14305
Ensembl: ENSG00000164309
Pharos: Q8N3K9(Tbio)
UniProt: Q8N3K9
Position
5:79689836..79800222
AA seq 4069 aa
MASRDSNHAGESFLGSDGDEEATRELETEEESEGEEDETAAESEEEPDSRLSDQDEEGKI
KQEYIISDPSFSMVTVQREDSGITWETNSSRSSTPWASEESQTSGVCSREGSTVNSPPGN
VSFIVDEVKKVRKRTHKSKHGSPSLRRKGNRKRNSFESQDVPTNKKGSPLTSASQVLTTE
KEKSYTGIYDKARKKKTTSNTPPITGAIYKEHKPLVLRPVYIGTVQYKIKMFNSVKEELI
PLQFYGTLPKGYVIKEIHYRKGKDASISLEPDLDNSGSNTVSKTRKLVAQSIEDKVKEVF
PPWRGALSKGSESLTLMFSHEDQKKIYADSPLNATSALEHTVPSYSSSGRAEQGIQLRHS
QSVPQQPEDEAKPHEVEPPSVTPDTPATMFLRTTKEECELASPGTAASENDSSVSPSFAN
EVKKEDVYSAHHSISLEAASPGLAASTQDGLDPDQEQPDLTSIERAEPVSAKLTPTHPSV
KGEKEENMLEPSISLSEPLMLEEPEKEEIETSLPIAITPEPEDSNLVEEEIVELDYPESP
LVSEKPFPPHMSPEVEHKEEELILPLLAASSPEHVALSEEEREEIASVSTGSAFVSEYSV
PQDLNHELQEQEGEPVPPSNVEAIAEHAVLSEEENEEFEAYSPAAAPTSESSLSPSTTEK
TSENQSPLFSTVTPEYMVLSGDEASESGCYTPDSTSASEYSVPSLATKESLKKTIDRKSP
LILKGVSEYMIPSEEKEDTGSFTPAVAPASEPSLSPSTTEKTSECQSPLPSTATSEHVVP
SEGEDLGSERFTPDSKLISKYAAPLNATQESQKKIINEASQFKPKGISEHTVLSVDGKEV
IGPSSPDLVVASEHSFPPHTTEMTSECQAPPLSATPSEYVVLSDEEAVELERYTPSSTSA
SEFSVPPYATPEAQEEEIVHRSLNLKGASSPMNLSEEDQEDIGPFSPDSAFVSEFSFPPY
ATQEAEKREFECDSPICLTSPSEHTILSDEDTEEAELFSPDSASQVSIPPFRISETEKNE
LEPDSLLTAVSASGYSCFSEADEEDIGSTAATPVSEQFSSSQKQKAETFPLMSPLEDLSL
PPSTDKSEKAEIKPEIPTTSTSVSEYLILAQKQKTQAYLEPESEDLIPSHLTSEVEKGER
EASSSVAAIPAALPAQSSIVKEETKPASPHSVLPDSVPAIKKEQEPTAALTLKAADEQMA
LSKVRKEEIVPDSQEATAHVSQDQKMEPQPPNVPESEMKYSVLPDMVDEPKKGVKPKLVL
NVTSELEQRKLSKNEPEVIKPYSPLKETSLSGPEALSAVKMEMKHDSKITTTPIVLHSAS
SGVEKQVEHGPPALAFSALSEEIKKEIEPSSSTTTASVTKLDSNLTRAVKEEIPTDSSLI
TPVDRPVLTKVGKGELGSGLPPLVTSADEHSVLAEEDKVAIKGASPIETSSKHLAWSEAE
KEIKFDSLPSVSSIAEHSVLSEVEAKEVKAGLPVIKTSSSQHSDKSEEARVEDKQDLLFS
TVCDSERLVSSQKKSLMSTSEVLEPEHELPLSLWGEIKKKETELPSSQNVSPASKHIIPK
GKDEETASSSPELENLASGLAPTLLLLSDDKNKPAVEVSSTAQGDFPSEKQDVALAELSL
EPEKKDKPHQPLELPNAGSEFSSDLGRQSGSIGTKQAKSPITETEDSVLEKGPAELRSRE
GKEENRELCASSTMPAISELSSLLREESQNEEIKPFSPKIISLESKEPPASVAEGGNPEE
FQPFTFSLKGLSEEVSHPADFKKGGNQEIGPLPPTGNLKAQVMGDILDKLSEETGHPNSS
QVLQSITEPSKIAPSDLLVEQKKTEKALHSDQTVKLPDVSTSSEDKQDLGIKQFSLMREN
LPLEQSKSFMTTKPADVKETKMEEFFISPKDENWMLGKPENVASQHEQRIAGSVQLDSSS
SNELRPGQLKAAVSSKDHTCEVRKQVLPHSAEESHLSSQEAVSALDTSSGNTETLSSKSY
SSEEVKLAEEPKSLVLAGNVERNIAEGKEIHSLMESESLLLEKANTELSWPSKEDSQEKI
KLPPERFFQKPVSGLSVEQVKSETISSSVKTAHFPAEGVEPALGNEKEAHRSTPPFPEEK
PLEESKMVQSKVIDDADEGKKPSPEVKIPTQRKPISSIHAREPQSPESPEVTQNPPTQPK
VAKPDLPEEKGKKGISSFKSWMSSLFFGSSTPDNKVAEQEDLETQPSPSVEKAVTVIDPE
GTIPTNFNVAEKPADHSLSEVKLKTADEPRGTLVKSGDGQNVKEKSMILSNVEDLQQPKF
ISEVSREDYGKKEISGDSEEMNINSVVTSADGENLEIQSYSLIGEKLVMEEAKTIVPPHV
TDSKRVQKPAIAPPSKWNISIFKEEPRSDQKQKSLLSFDVVDKVPQQPKSASSNFASKNI
TKESEKPESIILPVEESKGSLIDFSEDRLKKEMQNPTSLKISEEETKLRSVSPTEKKDNL
ENRSYTLAEKKVLAEKQNSVAPLELRDSNEIGKTQITLGSRSTELKESKADAMPQHFYQN
EDYNERPKIIVGSEKEKGEEKENQVYVLSEGKKQQEHQPYSVNVAESMSRESDISLGHSL
GETQSFSLVKATSVTEKSEAMLAEAHPEIREAKAVGTQPHPLEESKVLVEKTKTFLPVAL
SCRDEIENHSLSQEGNLVLEKSSRDMPDHSEEKEQFRESELSKGGSVDITKETVKQGFQE
KAVGTQPRPLEESKVLVEKTKTFLPVVLSCHDEIENHSLSQEGNLVLEKSSRDMPDHSEE
KEQFKESELWKGGSVDITKESMKEGFPSKESERTLARPFDETKSSETPPYLLSPVKPQTL
ASGASPEINAVKKKEMPRSELTPERHTVHTIQTSKDDTSDVPKQSVLVSKHHLEAAEDTR
VKEPLSSAKSNYAQFISNTSASNADKMVSNKEMPKEPEDTYAKGEDFTVTSKPAGLSEDQ
KTAFSIISEGCEILNIHAPAFISSIDQEESEQMQDKLEYLEEKASFKTIPLPDDSETVAC
HKTLKSRLEDEKVTPLKENKQKETHKTKEEISTDSETDLSFIQPTIPSEEDYFEKYTLID
YNISPDPEKQKAPQKLNVEEKLSKEVTEETISFPVSSVESALEHEYDLVKLDESFYGPEK
GHNILSHPETQSQNSADRNVSKDTKRDVDSKSPGMPLFEAEEGVLSRTQIFPTTIKVIDP
EFLEEPPALAFLYKDLYEEAVGEKKKEEETASEGDSVNSEASFPSRNSDTDDGTGIYFEK
YILKDDILHDTSLTQKDQGQGLEEKRVGKDDSYQPIAAEGEIWGKFGTICREKSLEEQKG
VYGEGESVDHVETVGNVAMQKKAPITEDVRVATQKISYAVPFEDTHHVLERADEAGSHGN
EVGNASPEVNLNVPVQVSFPEEEFASGATHVQETSLEEPKILVPPEPSEERLRNSPVQDE
YEFTESLHNEVVPQDILSEELSSESTPEDVLSQGKESFEHISENEFASEAEQSTPAEQKE
LGSERKEEDQLSSEVVTEKAQKELKKSQIDTYCYTCKCPISATDKVFGTHKDHEVSTLDT
AISAVKVQLAEFLENLQEKSLRIEAFVSEIESFFNTIEENCSKNEKRLEEQNEEMMKKVL
AQYDEKAQSFEEVKKKKMEFLHEQMVHFLQSMDTAKDTLETIVREAEELDEAVFLTSFEE
INERLLSAMESTASLEKMPAAFSLFEHYDDSSARSDQMLKQVAVPQPPRLEPQEPNSATS
TTIAVYWSMNKEDVIDSFQVYCMEEPQDDQEVNELVEEYRLTVKESYCIFEDLEPDRCYQ
VWVMAVNFTGCSLPSERAIFRTAPSTPVIRAEDCTVCWNTATIRWRPTTPEATETYTLEY
CRQHSPEGEGLRSFSGIKGLQLKVNLQPNDNYFFYVRAINAFGTSEQSEAALISTRGTRF
LLLRETAHPALHISSSGTVISFGERRRLTEIPSVLGEELPSCGQHYWETTVTDCPAYRLG
ICSSSAVQAGALGQGETSWYMHCSEPQRYTFFYSGIVSDVHVTERPARVGILLDYNNQRL
IFINAESEQLLFIIRHRFNEGVHPAFALEKPGKCTLHLGIEPPDSVRHK
NT seq 12210 nt   +upstreamnt  +downstreamnt
atggcgagccgcgatagcaaccacgctggcgagagctttctcggctccgacggggacgag
gaggcgacccgggagctggagaccgaggaggagtcggagggcgaggaggacgagacggcg
gcggagtcggaggaggagccggactccaggttatcagaccaggatgaagagggaaagatc
aagcaggagtatatcatatctgacccctccttttccatggtgacagtccaaagggaagat
agtgggataacctgggaaaccaattcaagtagatcttctactccttgggcttcagaagaa
agtcagacttctggtgtgtgtagtcgggaagggtcaactgtgaattctcctcctggaaat
gtttcctttattgtggatgaagtgaaaaaggttcggaaaaggactcataagtcaaagcat
ggttcaccatcattacgccggaaaggcaacagaaaaagaaattcttttgaatcccaagat
gttccaacaaacaaaaaaggcagtcctttaacttcagcaagccaggtactaaccacggag
aaagagaagtcatatactggcatttatgataaagcaagaaaaaagaagaccacttcaaat
acacctccgattactggggcaatatacaaagaacacaagccattagtgttaagaccagtc
tacataggaacagtacaatataaaattaagatgtttaattcggttaaagaagaattaatt
cctctacaattttatggaacattgccaaagggttatgtaattaaagaaatacattatagg
aaagggaaagatgcatccattagtctagagccagatttggacaatagtggttctaataca
gtgtccaaaacacgcaaattagtagcccaaagcatagaggataaagtaaaagaggttttt
ccaccctggagaggcgcactctccaaaggatcagagtccctaaccttaatgttcagtcat
gaagatcaaaagaaaatttatgctgattctcccctaaatgccacatctgcattggagcac
acagttccctcttattcaagtagtggcagagcagaacaaggaatacagctcaggcattca
cagtcagtgccacaacagccagaagatgaagcaaaaccacatgaagtggaacctccatct
gtgacacccgacacacctgcaactatgttcctgagaacaacaaaggaagaatgtgagctt
gcttcaccaggaactgcagcttcagagaatgactcttcagtctcaccatcatttgctaat
gaggtaaagaaggaagatgtgtattctgctcaccattccatttctctggaggcagcgtca
ccaggtctggcagcatctacccaggatggtttggacccagaccaagaacagccggacctg
acttcaatagaaagggcagaaccagtctccgcaaaactgacccctacccatcccagtgtc
aaaggagagaaggaggaaaacatgcttgagccatccatttctctttctgaacctctaatg
ttagaagaaccagagaaagaagaaatagaaacttccctacccatagctattacccctgaa
cctgaagattctaatttagtagaagaagagatcgtagaacttgattacccagaaagccca
ttggtttccgagaagcccttcccaccacatatgtcccctgaagtggagcacaaagaagaa
gagcttattctaccattattggcagcatcatctcctgaacatgttgctttgtctgaggaa
gaaagagaggaaattgcatctgtttctactggttctgcttttgtatcagagtattcagta
ccacaggatttgaaccatgaattacaggagcaagaaggtgagccagttcccccatccaat
gtagaagctatagctgaacatgcagttttgtcagaagaagagaatgaggaatttgaggct
tattccccagctgcagcccctacatctgagagctctctctcaccatccacaactgagaag
acttcagagaaccagtctccactgttttcaacagttacaccagaatacatggtcctatca
ggagacgaggcctcagaaagtgggtgttacacaccagactccacatctgcttctgaatat
tcagttccatcactggcaacaaaagagtcactgaagaaaacaattgaccgtaagtccccg
ttaatattgaaaggtgtttctgagtacatgattccatcagaagagaaggaagacactgga
tcgtttactccagctgtggcccctgcttctgagccctctctctcaccatccacaaccgaa
aagacttctgaatgccagtcaccactgccttctactgccacatcagaacacgtggtccca
tcagaaggagaggacctaggaagtgaacgtttcacaccggattcaaagttgatctccaaa
tatgcagccccactcaatgcaacacaggaatctcaaaagaaaataatcaatgaggcatcc
caattcaaaccaaaaggtatttctgagcacacagttctgtcagtagacggcaaggaggtc
attggaccatcttccccagatttggttgttgcatctgaacactctttcccaccacacaca
accgagatgacttctgaatgccaggccccaccactttcagccaccccatctgaatatgtt
gttctatcagacgaagaggcagtcgagttggaacgatacacaccctcttctacatctgct
tctgaattttcagtaccaccatatgcaacaccggaggcacaggaggaagaaattgtccat
agatctctaaatctaaaaggtgcatcctcacccatgaatttatcagaagaagatcaagaa
gacattggacctttttctccagattctgcatttgtgtcagaattctcatttccaccgtat
gcaacccaggaagcagagaaaagagaatttgagtgcgattctccaatatgtttaacatca
ccatctgagcacactattttgtcagatgaagacactgaagaagcggaactgttctctcca
gactcagcatcacaagtttcaatccctccctttagaatctcagaaacagagaaaaatgaa
cttgagcctgattcactattaactgcagtgtctgcttcaggttattcctgcttttcagaa
gcagatgaggaagacattggatccacagctgctacacctgtatctgagcagttcagttca
tcacagaagcaaaaagctgaaactttccctttgatgtctccgcttgaagacttaagtctg
ccgccttcaacagataaatcagagaaagcagaaattaagccagagattccaacaacctca
acatctgtatctgaatatctcattttggcacagaagcagaaaactcaagcatatttagag
cctgagtctgaagacttgattccttcacatttaaccagtgaagtggagaagggagaaagg
gaggcaagttcatcagtagctgcaatacctgctgctttacctgcacaatcatctatagta
aaggaagaaaccaaacctgcatctccacattcagttttacctgattcagtccctgcaatc
aagaaagaacaggaacccacagcagcactcactctaaaagctgcagatgaacagatggct
ttgtcaaaagtcagaaaggaagaaattgtgcctgattctcaagaagctacagcacatgta
tcacaggatcaaaaaatggagcctcagcctccaaatgttccagagtctgagatgaaatat
tcagttttgcctgacatggtagatgagccaaagaagggtgtcaagcccaaattagttcta
aatgtgacttctgaactagaacagagaaagttgtccaagaatgagcctgaagtaataaaa
ccatattcacctctaaaggaaacatctttatctggacctgaggctttatcagcagtgaaa
atggagatgaaacatgattccaaaataacaactacacctatagtgcttcattcagcttcc
tcaggagtggaaaagcaagttgaacatggtccacctgcactagcattttcagctttgtca
gaagaaattaaaaaagaaattgaacccagttcctcaacaactacagcatctgtaactaag
cttgattcaaacttaaccagagcagtaaaagaagaaatcccaacagattcatctcttatc
actcctgtagatcgtccagtcttaacaaaagtaggaaagggtgaattaggaagtggtttg
ccaccactggtaacatctgcagatgaacattcagttcttgcagaagaagacaaggtggca
attaaaggtgcttctcccattgaaacttcatccaaacatttagcttggtcagaagcagag
aaggaaattaaatttgattcacttccaagtgtctcctctatagcagagcattctgttttg
tcagaagtagaagccaaagaagttaaagctgggttgccagtaatcaaaacatcatcttct
cagcattcagataaatctgaggaagcaagggtagaagacaaacaagatcttttattttct
acagtctgtgactctgaacgtttggtttcatcacagaagaagagcttgatgtctacctca
gaggtgttagagcctgaacatgagcttccactcagcctatggggtgagataaagaagaaa
gaaactgaacttccttcatcacaaaatgtgtcacctgcatccaaacatataatcccaaaa
ggcaaagatgaggaaacagcaagttcatctcctgagttggaaaatttagcatcaggttta
gccccaacattactgctcctcagtgatgataagaacaaaccggcagtggaggtatcttct
acagctcagggagacttcccatcagaaaaacaagatgttgctttggcagagctgtctttg
gaacctgagaagaaagacaagccacaccaaccgttggaattaccaaatgctgggtcagaa
ttttctagtgatttaggtagacaaagtggatccataggtacaaaacaagcaaagtctccc
ataactgaaacagaggattctgttttagaaaaaggcccagctgagcttaggagcagagaa
ggaaaagaagaaaatagagagctttgtgcatcttctacgatgcctgcaatttcagagctt
tcatcattgcttagggaggaatctcagaatgaagaaattaaacctttctctcccaagatc
atcagcctagagtcgaaagaaccacctgcctctgtagctgaaggaggcaacccagaagaa
tttcagccatttactttttctttaaaaggattatcagaggaggttagccatccagccgac
tttaaaaagggaggaaatcaagaaataggcccattaccaccaactggaaatttgaaggca
caagtcatgggagatattttagataagctaagtgaagaaacaggccacccaaattcatcc
caggtactccagagtataacagaaccatcaaagattgctccttctgacctccttgtagaa
caaaaaaagacagaaaaagcacttcattcagatcaaactgttaaattacctgatgtaagc
acctcttctgaagataaacaagatctgggtattaagcagttttcacttatgagagagaat
ttgcctttggaacaatcaaaatcatttatgacaaccaagcctgcggatgtcaaagaaaca
aaaatggaagaattctttatttctccaaaggatgaaaactggatgttgggaaagccagaa
aatgtggctagtcaacacgaacagagaatagcaggatctgtgcagctggattcctctagc
agcaatgagctgaggccagggcagctcaaggctgctgtgtccagtaaggaccatacatgt
gaagtgagaaagcaggtcctgccgcattctgctgaagaatctcatttgtcatcacaagaa
gcagtatctgctcttgatacttccagtggtaatacagagaccttatcaagtaaaagttac
tcttctgaagaagtaaagctggctgaagaaccaaagtctttagtcctagctggaaatgta
gagagaaacatagcagaggggaaggagattcattctttgatggagagtgaaagtttgcta
ttggagaaagcaaacacagagctttcctggccttccaaagaagatagccaggaaaaaatt
aaactacctcctgaaagattcttccagaaaccagtgtctggcctatcagtggaacaggtg
aagtcagaaacaatctcctcttctgtcaaaacagcccatttcccggcagaaggtgtggaa
cctgcattgggcaatgaaaaagaagcacacaggagcacacctccttttcctgaagagaag
ccattggaagaatcaaaaatggttcagtcaaaggttattgatgatgctgatgagggaaag
aaaccatcacctgaagtaaaaatacccacacaaagaaaacccatctcctcaatccatgca
agagagcctcaatccccagagtcacctgaggtgacacaaaatccacctacacaaccaaag
gtggctaagccggaccttcctgaggaaaagggaaagaaaggaatttcatctttcaaatcg
tggatgtccagcttgttttttggatcgagcactccagataacaaagttgctgaacaagaa
gacttagaaacacagccaagtccatccgtagaaaaagcagtgactgtgatagatcctgaa
ggtacaattcccaccaattttaatgtagctgagaaaccagctgatcattcattatcagag
gtaaaacttaaaactgctgatgaacccagaggtactttagtaaaatctggtgacggtcaa
aacgttaaagaaaaatccatgattttatcaaatgtagaagatttacaacagccaaaattc
atttctgaggtgtctagggaagattatggaaaaaaagaaatctcaggcgattcagaggaa
atgaacataaactcagtagttacttctgctgatggtgagaaccttgaaattcaatcttat
tcactaatcggtgagaaattggttatggaagaagccaaaactattgttcctcctcatgtt
actgatagtaaaagagtccagaagccagcaatcgctcctccatctaaatggaatatttct
atttttaaggaagagccaagaagtgatcaaaaacaaaaatcactcctttcatttgatgta
gtagataaggtgccacaacagccaaaatcagcttcctccaactttgcaagtaaaaatatc
acaaaggaatcagagaaaccagagtcaattattttgccagtagaagaatcaaaaggcagt
ttaattgatttcagtgaagacagactcaagaaagaaatgcaaaatcctacttccttgaaa
atttctgaagaggaaacaaaactcaggtctgttagtccaactgagaagaaagataatttg
gaaaacagatcatataccttggcagaaaagaaggtgctggcagaaaaacaaaactctgtg
gccccattagagcttagagatagtaatgaaatagggaagacacaaattacacttggatct
agatctactgaactgaaagaatcaaaagccgatgctatgccacagcacttctatcaaaat
gaagactacaatgaaagacccaaaatcattgttggttctgaaaaggagaaaggtgaagaa
aaagaaaatcaggtatatgtgctttcagaaggaaagaagcagcaggaacatcagccttat
tctgtgaatgtagccgagtctatgagtagagaatcagatatctctttaggtcattctttg
ggtgaaactcaatcattttcattagttaaagctacatcagttactgaaaaatcagaagcc
atgctcgcagaggctcacccagaaatcagagaagcaaaggcagtaggaacccaaccacat
cctttagaagaaagtaaagttttggtggagaaaaccaagactttcctgccggtggctctt
tcttgtcgtgatgaaatagagaaccactctttatctcaggaaggaaatctagtattagaa
aagtcaagcagagatatgccagatcacagtgaagaaaaagaacagttcagagagtcagag
ctatcgaaaggcggttcagtagatatcacaaaagaaactgtgaaacaaggatttcaagaa
aaggcagtaggaacccaaccacgtcctttagaagaaagtaaagttttggtggagaaaact
aagactttcctgccagtggttctttcttgtcatgatgaaatagagaaccactctttgtct
caggaaggaaatctagtgttagaaaagtcaagcagagatatgccagatcacagtgaagaa
aaagaacagttcaaagagtcagagctatggaaaggtggttcagtagatatcacaaaagaa
agtatgaaagaaggatttccatctaaagaatccgaaaggactttagctcgtccttttgat
gaaactaagagctcagaaacaccgccatatttgctgtcacctgtaaaaccacaaactctt
gcttcaggagcttctccagaaattaacgcagtgaagaaaaaagaaatgccacgatcagaa
ttgactccagaaaggcatacagttcatactattcagacatctaaagatgacacatccgat
gtgcctaaacaatctgttcttgtttcaaagcaccacttggaggctgcggaagatacccgt
gtaaaggaaccactgtcttcagcaaaaagcaactatgctcaatttatatctaatacatca
gcaagcaatgctgataaaatggtttctaataaagaaatgcccaaggaacctgaagacaca
tatgcaaaaggtgaagactttacagtgactagtaagccagccggactttcagaagatcag
aagactgcctttagtatcatttctgaaggctgtgagatattgaatattcatgctccggcc
tttatttcttcaatcgatcaggaagaaagtgaacaaatgcaagataaattagaatatttg
gaagagaaagcctcatttaaaaccataccactccctgatgatagtgaaacagttgcttgt
cataaaacattaaagagcaggttagaagatgaaaaagttaccccattgaaagaaaataaa
caaaaggaaactcataagacaaaagaagagatatccacagattcagaaactgatttatca
tttattcagcccacaattcccagtgaagaggattattttgaaaaatatactttgattgat
tataacatctccccagacccagaaaaacagaaagctccacagaaattaaatgttgaagag
aaactctcaaaggaagttacagaagaaactatctctttcccagtaagttcagtggaaagt
gcactagaacatgaatatgacttggtgaaattagatgaaagtttttatggaccagaaaag
ggccacaacatattatctcatccagagacccaaagccaaaactcagctgacaggaatgtt
tcaaaggacacaaagagagatgtggactcaaagtcaccggggatgcctttatttgaagca
gaggaaggagttctatcacgaacccagatatttcctaccactattaaagtcattgatcca
gaatttctggaggagccacctgcacttgcatttttatataaggatctgtatgaagaagca
gttggagagaaaaagaaggaagaggagacagcttctgaaggtgacagtgtgaattctgag
gcatcatttcccagcagaaattctgacactgatgatggaacaggaatatattttgagaag
tacatactcaaagatgacattctccatgacacatctctaactcaaaaggaccagggccaa
ggtctggaagaaaaacgagttggtaaggatgattcataccaaccgatagctgcagaaggg
gaaatttggggaaagtttggaactatttgcagggagaagagtctggaagaacagaaaggt
gtttatggggaaggagaatcagtagaccatgtggagaccgttggtaacgtagcgatgcag
aagaaagctcccatcacagaggacgtcagagtggctacccagaaaataagttatgcggtt
ccatttgaagacacccatcatgttctggagcgtgcagatgaagcaggcagtcacggtaat
gaagtcggaaatgcaagtccagaggtcaatctgaatgtcccagtacaagtgtccttcccg
gaggaagaatttgcatctggtgcaactcatgttcaagaaacatcactagaagaacctaaa
atcctggtcccacctgagccaagtgaagagaggctccgtaatagccctgttcaggatgag
tatgaatttacagaatccctgcataatgaagtggttcctcaagacatattatcagaagaa
ctgtcttcagaatccacacctgaagatgtcttatctcaaggaaaggaatcctttgagcac
atcagtgaaaatgaatttgcgagtgaggcagaacaaagtacacctgctgaacaaaaagag
ttgggcagcgagaggaaagaagaagaccaattatcatctgaggtagtaactgaaaaggca
caaaaagagctgaaaaagtcccagattgacacatactgttacacctgcaaatgtccaatt
tctgccactgacaaggtgtttggcacccacaaagaccatgaagtttcaacgcttgacaca
gctataagtgctgtaaaggttcaattagcagaatttctagaaaatttacaagaaaagtcc
ttgaggattgaagcctttgttagtgagatagaatccttttttaataccattgaggaaaac
tgtagtaaaaatgagaaaaggctagaagaacagaatgaggaaatgatgaagaaggtttta
gcacagtatgatgagaaagcccagagctttgaggaagtgaagaagaagaagatggagttc
ctgcatgagcagatggtccactttctgcagagcatggacactgccaaagacaccctggag
accatcgtgagagaagcagaggagcttgatgaggccgtcttcctgacttcgtttgaggaa
atcaatgaaaggttgctttctgcaatggagagcactgcttctttagagaaaatgcctgct
gcgttttcccttttcgaacattatgatgacagctcggcaagaagtgaccagatgttaaaa
caagtggctgttccacagcctcctagattagaacctcaggaaccaaattctgccaccagc
acaacaattgcagtttactggagcatgaacaaggaagatgtcattgattcatttcaggtt
tactgcatggaggagccacaagatgatcaagaagtaaatgagttggtagaagaatacaga
ctgacagtgaaagaaagctactgcatttttgaagatctggaacctgaccgatgctatcaa
gtgtgggtgatggctgtgaacttcactggatgtagcctgcccagtgaaagggccatcttt
aggacagcaccctccacccctgtgatccgcgctgaggactgtactgtgtgttggaacaca
gccactatccgatggcggcccaccaccccagaggccacggagacctacactctggagtac
tgcagacagcactctcctgagggagagggcctcagatctttctctggaatcaaaggactc
cagctgaaagttaacctccaacccaatgataactactttttctatgtgagggccatcaat
gcatttgggacaagtgaacagagtgaagctgctctcatctccaccagaggaaccagattt
ctcttgttgagagaaacagctcatcctgctctacacatttcctcaagtgggacagtgatc
agctttggtgagaggagacggctgacggaaatcccgtcagtgctgggtgaggagctgcct
tcctgtggccagcattactgggaaaccacagtcacagactgcccagcatatcgactcggc
atctgctccagctcggctgtgcaggcaggtgccctaggacaaggggagacctcatggtac
atgcactgctctgagccacagagatacacatttttctacagtggtattgtgagtgatgtt
catgtgactgagcgtccagccagagtgggcatcctgctggactacaacaaccagagactt
atcttcatcaacgcagagagcgagcagttgctcttcatcatcaggcacaggtttaatgag
ggtgtccaccctgcctttgccctggagaaacctggaaaatgtactttgcacctggggata
gagcccccggattctgtaaggcacaagtga

DBGET integrated database retrieval system