KEGG   Homo sapiens (human): 203427
Entry
203427            CDS       T01001                                 

Gene name
SLC25A43
Definition
(RefSeq) solute carrier family 25 member 43
  KO
K15120  solute carrier family 25, member 43
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    203427 (SLC25A43)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   203427 (SLC25A43)
SSDB
Motif
Pfam: Mito_carr SLC25_like DUF5835
Other DBs
NCBI-GeneID: 203427
NCBI-ProteinID: NP_660348
OMIM: 300641
HGNC: 30557
Ensembl: ENSG00000077713
Vega: OTTHUMG00000022272
Pharos: Q8WUT9(Tdark)
UniProt: Q8WUT9
Position
Xq24
AA seq 341 aa
MATWRRDGRLTGGQRLLCAGLAGTLSLSLTAPLELATVLAQVGVVRGHARGPWATGHRVW
RAEGLRALWKGNAVACLRLFPCSAVQLAAYRKFVVLFTDDLGHISQWSSIMAGSLAGMVS
TIVTYPTDLIKTRLIMQNILEPSYRGLLHAFSTIYQQEGFLALYRGVSLTVVGALPFSAG
SLLVYMNLEKIWNGPRDQFSLPQNFANVCLAAAVTQTLSFPFETVKRKMQAQSPYLPHSG
GVDVHFSGAVDCFRQIVKAQGVLGLWNGLTANLLKIVPYFGIMFSTFEFCKRICLYQNGY
ILSPLSYKLTPGVDQSLQPQELRELKKFFKTRKPKPKKPTL
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggctacgtggaggcgggacggccgactgacaggcggccaaaggctgctgtgcgctggg
ctggcggggacgctcagcctcagcctcaccgcgcccctggagctcgccaccgtgctggcc
caggttggcgtcgtgcgaggccacgcccggggaccgtgggccacagggcaccgggtgtgg
cgggcagaggggctccgggccctgtggaaggggaacgcggtggcgtgcctgcgcctcttc
ccctgcagcgccgtgcagctcgccgcctaccgcaaatttgttgtgctgttcacagatgac
ctgggccacatttcccagtggagctccatcatggctgggagtctcgcaggcatggtttcc
accattgtaacatatcctacagacctcatcaaaacccggttgatcatgcagaacatactg
gaaccatcgtacagggggctcctccatgctttttctactatttaccaacaggaagggttc
cttgccctttatcgaggggtttccctcactgttgtaggtgctctcccgttctctgctggc
tcccttcttgtttacatgaacctggagaaaatctggaacggaccccgagatcagttctct
ctcccacagaactttgctaatgtctgtctggctgctgcagtgacccagaccctctccttt
ccctttgagaccgtgaagagaaagatgcaggctcagagcccctacctcccacacagtgga
ggagtagatgtccatttctcaggagcagtggactgcttccggcagatagtgaaggcccag
ggggtcctggggctctggaatggattgacagccaatttactgaagatagttccatatttt
ggaattatgtttagcacctttgagttctgcaagagaatctgtctttatcaaaatggttac
attctgtctccactgagctataaattgaccccaggagtcgatcagagtttgcagccccag
gaattacgagaattaaagaagttcttcaaaacgagaaaaccgaagcctaaaaaaccaact
ctataa

DBGET integrated database retrieval system