KEGG   Homo sapiens (human): 2041Help
Entry
2041              CDS       T01001                                 

Gene name
EPHA1, EPH, EPHT, EPHT1
Definition
(RefSeq) EPH receptor A1
  KO
K05102  Eph receptor A1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Drug target
Sitravatinib: D11140
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    2041 (EPHA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2041 (EPHA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2041 (EPHA1)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2041 (EPHA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Ephrin_rec_like Pur_ac_phosph_N Haspin_kinase Kdo Tissue_fac
Motif
Other DBs
NCBI-GeneID: 2041
NCBI-ProteinID: NP_005223
OMIM: 179610
HGNC: 3385
Ensembl: ENSG00000146904
Vega: OTTHUMG00000155894
Pharos: P21709(Tchem)
UniProt: P21709
Structure
PDB: 

Position
7q34-q35
AA seq 976 aa AA seqDB search
MERRWPLGLGLVLLLCAPLPPGARAKEVTLMDTSKAQGELGWLLDPPKDGWSEQQQILNG
TPLYMYQDCPMQGRRDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKE
TFNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLVSGSVKLNVERCSLGRLTRRG
LYLAFHNPGACVALVSVRVFYQRCPETLNGLAQFPDTLPGPAGLVEVAGTCLPHARASPR
PSGAPRMHCSPDGEWLVPVGRCHCEPGYEEGGSGEACVACPSGSYRMDMDTPHCLTCPQQ
STAESEGATICTCESGHYRAPGEGPQVACTGPPSAPRNLSFSASGTQLSLRWEPPADTGG
RQDVRYSVRCSQCQGTAQDGGPCQPCGVGVHFSPGARGLTTPAVHVNGLEPYANYTFNVE
AQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLT
YELHVLNQDEERYQMVLEPRVLLTELQPDTTYIVRVRMLTPLGPGPFSPDHEFRTSPPVS
RGLTGGEIVAVIFGLLLGAALLLGILVFRSRRAQRQRQQRQRDRATDVDREDKLWLKPYV
DLQAYEDPAQGALDFTRELDPAWLMVDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTLKD
TSPGGQWWNFLREATIMGQFSHPHILHLEGVVTKRKPIMIITEFMENGALDAFLREREDQ
LVPGQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDFDGT
YETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIE
DGYRLPPPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQLLANPHSLRTIANFDPRM
TLRLPSLSGSDGIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITL
PGHQKRILCSIQGFKD
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atggagcggcgctggcccctggggctagggctggtgctgctgctctgcgccccgctgccc
ccgggggcgcgcgccaaggaagttactctgatggacacaagcaaggcacagggagagctg
ggctggctgctggatcccccaaaagatgggtggagtgaacagcaacagatactgaatggg
acacccctgtacatgtaccaggactgcccaatgcaaggacgcagagacactgaccactgg
cttcgctccaattggatctaccgcggggaggaggcttcccgcgtccacgtggagctgcag
ttcaccgtgcgggactgcaagagtttccctgggggagccgggcctctgggctgcaaggag
accttcaaccttctgtacatggagagtgaccaggatgtgggcattcagctccgacggccc
ttgttccagaaggtaaccacggtggctgcagaccagagcttcaccattcgagaccttgtg
tctggctccgtgaagctgaatgtggagcgctgctctctgggccgcctgacccgccgtggc
ctctacctcgctttccacaacccgggtgcctgtgtggccctggtgtctgtccgggtcttc
taccagcgctgtcctgagaccctgaatggcttggcccaattcccagacactctgcctggc
cccgctgggttggtggaagtggcggggacctgcttgccccacgcgcgggccagccccagg
ccctcaggtgcaccccgcatgcactgcagccctgatggcgagtggctggtgcctgtagga
cggtgccactgtgagcctggctatgaggaaggtggcagtggcgaagcatgtgttgcctgc
cctagcggctcctaccggatggacatggacacaccccattgtctcacgtgcccccagcag
agcactgctgagtctgagggggccaccatctgtacctgtgagagcggccattacagagct
cccggggagggcccccaggtggcatgcacaggtcccccctcggccccccgaaacctgagc
ttctctgcctcagggactcagctctccctgcgttgggaacccccagcagatacgggggga
cgccaggatgtcagatacagtgtgaggtgttcccagtgtcagggcacagcacaggacggg
gggccctgccagccctgtggggtgggcgtgcacttctcgccgggggcccgggggctcacc
acacctgcagtgcatgtcaatggccttgaaccttatgccaactacacctttaatgtggaa
gcccaaaatggagtgtcagggctgggcagctctggccatgccagcacctcagtcagcatc
agcatggggcatgcagagtcactgtcaggcctgtctctgagactggtgaagaaagaaccg
aggcaactagagctgacctgggcggggtcccggccccgaagccctggggcgaacctgacc
tatgagctgcacgtgctgaaccaggatgaagaacggtaccagatggttctagaacccagg
gtcttgctgacagagctgcagcctgacaccacatacatcgtcagagtccgaatgctgacc
ccactgggtcctggccctttctcccctgatcatgagtttcggaccagcccaccagtgtcc
aggggcctgactggaggagagattgtagccgtcatctttgggctgctgcttggtgcagcc
ttgctgcttgggattctcgttttccggtccaggagagcccagcggcagaggcagcagagg
cagcgtgaccgcgccaccgatgtggatcgagaggacaagctgtggctgaagccttatgtg
gacctccaggcatacgaggaccctgcacagggagccctggactttacccgggagcttgat
ccagcgtggctgatggtggacactgtcataggagaaggagagtttggggaagtgtatcga
gggaccctgaggctccccagccaggactgcaagactgtggccattaagaccttaaaagac
acatccccaggtggccagtggtggaacttccttcgagaggcaactatcatgggccagttt
agccacccgcatattctgcatctggaaggcgtcgtcacaaagcgaaagccgatcatgatc
atcacagaatttatggagaatggagccctggatgccttcctgagggagcgggaggaccag
ctggtccctgggcagctagtggccatgctgcagggcatagcatctggcatgaactacctc
agtaatcacaattatgtccaccgggacctggctgccagaaacatcttggtgaatcaaaac
ctgtgctgcaaggtgtctgactttggcctgactcgcctcctggatgactttgatggcaca
tacgaaacccagggaggaaagatccctatccgttggacagcccctgaagccattgcccat
cggatcttcaccacagccagcgatgtgtggagctttgggattgtgatgtgggaggtgctg
agctttggggacaagccttatggggagatgagcaatcaggaggttatgaagagcattgag
gatgggtaccggttgccccctcctgtggactgccctgcccctctgtatgagctcatgaag
aactgctgggcatatgaccgtgcccgccggccacacttccagaagcttcaggcacatctg
gagcaactgcttgccaacccccactccctgcggaccattgccaactttgaccccaggatg
actcttcgcctgcccagcctgagtggctcagatgggatcccatatcgaaccgtctctgag
tggctcgagtccatacgcatgaaacgctacatcctgcacttccactcggctgggctggac
accatggagtgtgtgctggagctgaccgctgaggacctgacgcagatgggaatcacactg
cccgggcaccagaagcgcattctttgcagtattcagggattcaaggactga

DBGET integrated database retrieval system