KEGG   Homo sapiens (human): 2051
Entry
2051              CDS       T01001                                 

Gene name
EPHB6, HEP
Definition
(RefSeq) EPH receptor B6
  KO
K05114  Eph receptor B6 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    2051 (EPHB6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2051 (EPHB6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2051 (EPHB6)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2051 (EPHB6)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_2 EphA2_TM SAM_1 Ephrin_rec_like Pur_ac_phosph_N Phage_holin_5_1
Other DBs
NCBI-GeneID: 2051
NCBI-ProteinID: NP_004436
OMIM: 602757
HGNC: 3396
Ensembl: ENSG00000106123
Vega: OTTHUMG00000155707
Pharos: O15197(Tchem)
UniProt: O15197 F8WCM8
Position
7q34
AA seq 1022 aa
MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVS
VLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVS
GGTCRETFTLYYRQAEEPDSPDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSSSSAAW
AVGPHGAGQRAGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRSF
ASFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGC
RCQPGYQPARGDKACQACPRGLYKASAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASS
DPPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASG
GGGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAI
NVSTSHEVPSAVPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLT
SETNTATVTQLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGS
ILGALAFLLLAAITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIR
ELAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVAIQALWAGGAESLQMTFLGR
AAVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGV
AAAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHT
TSSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQ
KDRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSA
IGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSV
EV
NT seq 3069 nt   +upstreamnt  +downstreamnt
atggctactgaaggggctgcccagttagggaacagagtggcgggcatggtgtgtagccta
tgggtgctgctcctggtgtcttcagttctggctctggaagaggtattgctggacaccacc
ggagagacatctgagattggctggctcacctacccaccaggggggtgggacgaggtgagt
gttctggacgaccagcgacgcctgactcggacctttgaggcatgtcatgtggcaggggcc
cctccaggcaccgggcaggacaattggttgcagacacactttgtggagcggcgcggggcc
cagagggcgcacattcgactccacttctctgtgcgggcatgctccagcctgggtgtgagc
ggcggcacctgccgggagaccttcaccctttactaccgtcaggctgaggagcccgacagc
cctgacagcgtttcctcctggcacctcaaacgctggaccaaggtggacacaattgcagca
gacgagagctttccctcctcctcctcctcctcctcctcctcttcttcctctgcagcgtgg
gctgtgggaccccacggggctgggcagcgggctggactgcaactgaacgtcaaagagcgg
agctttgggcctctcacccaacgcggcttctacgtggccttccaggacacgggggcctgc
ctggccctggtcgctgtcaggctcttctcctacacctgccctgccgtgctccgatccttt
gcttcctttccagagacgcaggccagtggggctgggggggcctccctggtggcagctgtg
ggcacctgtgtggctcatgcagagccagaggaggatggagtagggggccaggcaggaggc
agcccccccaggctgcactgcaacggggagggcaagtggatggtagctgtcgggggctgc
cgctgccagcctggataccaaccagcacgaggagacaaggcctgccaagcctgcccacgg
gggctctataaggcttctgctgggaatgctccctgctcaccatgccctgcccgcagtcac
gctcccaacccagcagcccccgtttgcccctgcctggagggcttctaccgggccagttcc
gacccaccagaggccccctgcactggtcctccatcggctccccaggagctttggtttgag
gtgcaaggctcagcactcatgctacactggcgcctgcctcgggagctggggggtcgaggg
gacctgctcttcaatgtcgtgtgcaaggagtgtgaaggccgccaggaacctgccagcggt
ggtgggggcacttgtcaccgctgcagggatgaggtccacttcgaccctcgccagagaggc
ctgactgagagccgagtgttagtggggggactccgggcacacgtaccctacatcttagag
gtgcaggctgttaatggggtgtctgagctcagccctgaccctcctcaggctgcagccatc
aatgtcagcaccagccatgaagtgccctctgctgtccctgtggtgcaccaggtgagccgg
gcatccaacagcatcacggtgtcctggccgcagcccgaccagaccaatgggaacatcctg
gactatcagctccgctactatgaccaggcagaagacgaatcccactccttcaccctgacc
agcgagaccaacactgccaccgtgacacagctgagccctggccacatctatggtttccag
gtgcgggcccggactgctgccggccacggcccctacgggggcaaagtctatttccagaca
cttcctcaaggggagctgtcttcccagcttccagaaagactctccttggtgatcggctcc
atcctgggggctttggccttcctcctgctggcagccatcaccgtgctggcggtcgtcttc
cagcggaagcggcgtgggactggctacacagagcagctgcagcaatacagcagcccagga
ctcggggtgaagtattacatcgacccctccacctacgaggacccctgtcaggccatccga
gaacttgcccgggaagtcgatcctgcttatatcaagattgaggaggtcattgggacaggc
tcttttggagaagtgcgccagggccgcctgcagccacggggacggagggagcagactgtg
gccatccaggccctgtgggccgggggcgccgaaagcctgcagatgaccttcctgggccgg
gccgcagtgctgggtcagttccagcaccccaacatcctgcggctggagggcgtggtcacc
aagagccgacccctcatggtgctgacggagttcatggagcttggccccctggacagcttc
ctcaggcagcgggagggccagttcagcagcctgcagctggtggccatgcagcggggagtg
gctgctgccatgcagtacctgtccagctttgccttcgtccatcgctcgctgtctgcccac
agcgtgctggtgaatagccacttggtgtgcaaggtggcccgtcttggccacagtcctcag
ggcccaagttgtttgcttcgctgggcagccccagaggtcattgcacatggaaagcataca
acatccagtgatgtctggagctttgggatactcatgtgggaagtgatgagttatggagaa
cggccttactgggacatgagtgagcaggaggtactaaatgcaatagagcaggagttccgg
ctgcccccgcctccaggctgtcctcctggattacatctacttatgttggacacttggcag
aaggaccgtgcccggcggcctcattttgaccagctggtggctgcatttgacaagatgatc
cgcaagccagataccctgcaggctggcggggacccaggggaaaggccttcccaggccctt
ctgacccctgtggccctggactttccttgtctggactcaccccaggcctggctttcagcc
attggactggagtgctaccaggacaacttctccaagtttggcctctgtaccttcagtgat
gtggctcagctcagcctagaagacctgcctgccctgggcatcaccctggctggccaccag
aagaagctgctgcaccacatccagctccttcagcaacacctgaggcagcagggctcagtg
gaggtctga

DBGET integrated database retrieval system