KEGG   Homo sapiens (human): 2053Help
Entry
2053              CDS       T01001                                 

Gene name
EPHX2, ABHD20, CEH, SEH
Definition
(RefSeq) epoxide hydrolase 2
  KO
K08726  soluble epoxide hydrolase / lipid-phosphate phosphatase [EC:3.3.2.10 3.1.3.76]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    2053 (EPHX2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    2053 (EPHX2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    2053 (EPHX2)
   01002 Peptidases and inhibitors [BR:hsa01002]
    2053 (EPHX2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.76  lipid-phosphate phosphatase
     2053 (EPHX2)
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.10  soluble epoxide hydrolase
     2053 (EPHX2)
Protein phosphatases and associated proteins [BR:hsa01009]
 HAD phosphatases
  Other HAD phosphatases
   2053 (EPHX2)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S33
   2053 (EPHX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 HAD_2 Hydrolase Hydrolase_like E2_bind Resolvase Ndr Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 2053
NCBI-ProteinID: NP_001970
OMIM: 132811
HGNC: 3402
Ensembl: ENSG00000120915
Vega: OTTHUMG00000102115
Pharos: P34913(Tchem)
UniProt: P34913
Structure
PDB: 

Position
8p21.2-p21.1
AA seq 555 aa AA seqDB search
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITL
SQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTA
ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEV
VFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG
YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS
APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT
PFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL
GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIK
WLDSDARNPPVVSKM
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcgcgcggccgtcttcgaccttgacggggtgctggcgctgccagcggtgttc
ggcgtcctcggccgcacggaggaggccctggcgctgcccagaggacttctgaatgatgct
ttccagaaagggggaccagagggtgccactacccggcttatgaaaggagagatcacactt
tcccagtggataccactcatggaagaaaactgcaggaagtgctccgagaccgctaaagtc
tgcctccccaagaatttctccataaaagaaatctttgacaaggcgatttcagccagaaag
atcaaccgccccatgctccaggcagctctcatgctcaggaagaaaggattcactactgcc
atcctcaccaacacctggctggacgaccgtgctgagagagatggcctggcccagctgatg
tgtgagctgaagatgcactttgacttcctgatagagtcgtgtcaggtgggaatggtcaaa
cctgaacctcagatctacaagtttctgctggacaccctgaaggccagccccagtgaggtc
gtttttttggatgacatcggggctaatctgaagccagcccgtgacttgggaatggtcacc
atcctggtccaggacactgacacggccctgaaagaactggagaaagtgaccggaatccag
cttctcaataccccggcccctctgccgacctcttgcaatccaagtgacatgagccatggg
tacgtgacagtaaagcccagggtccgtctgcattttgtggagctgggctccggccctgct
gtgtgcctctgccatggatttcccgagagttggtattcttggaggtaccagatccctgct
ctggcccaggcaggttaccgggtcctagctatggacatgaaaggctatggagagtcatct
gctcctcccgaaatagaagaatattgcatggaagtgttatgtaaggagatggtaaccttc
ctggataaactgggcctctctcaagcagtgttcattggccatgactggggtggcatgctg
gtgtggtacatggctctcttctaccccgagagagtgagggcggtggccagtttgaatact
cccttcataccagcaaatcccaacatgtcccctttggagagtatcaaagccaacccagta
tttgattaccagctctacttccaagaaccaggagtggctgaggctgaactggaacagaac
ctgagtcggactttcaaaagcctcttcagagcaagcgatgagagtgttttatccatgcat
aaagtctgtgaagcgggaggactttttgtaaatagcccagaagagcccagcctcagcagg
atggtcactgaggaggaaatccagttctatgtgcagcagttcaagaagtctggtttcaga
ggtcctctaaactggtaccgaaacatggaaaggaactggaagtgggcttgcaaaagcttg
ggacggaagatcctgattccggccctgatggtcacggcggagaaggacttcgtgctcgtt
cctcagatgtcccagcacatggaggactggattccccacctgaaaaggggacacattgag
gactgtgggcactggacacagatggacaagccaaccgaggtgaatcagatcctcattaag
tggctggattctgatgcccggaacccaccggtggtctcaaagatgtag

DBGET integrated database retrieval system