KEGG   Homo sapiens (human): 2054Help
Entry
2054              CDS       T01001                                 

Gene name
STX2, EPIM, EPM, STX2A, STX2B, STX2C
Definition
(RefSeq) syntaxin 2
  KO
K08486  syntaxin 1B/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    2054 (STX2)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    2054 (STX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2054 (STX2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2054 (STX2)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    2054 (STX2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   2054 (STX2)
  Exosomal proteins of other body fluids (saliva and urine)
   2054 (STX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Prominin DUF3671 Branch DUF16 DUF2207 ApoLp-III T2SSF YnfE YtxH DUF2205 ISG65-75 CbiA DUF2508
Motif
Other DBs
NCBI-GeneID: 2054
NCBI-ProteinID: NP_919337
OMIM: 132350
HGNC: 3403
Ensembl: ENSG00000111450
Vega: OTTHUMG00000168365
Pharos: P32856(Tbio)
UniProt: P32856
Position
12q24.33
AA seq 288 aa AA seqDB search
MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSII
LSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHS
VLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDI
ISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNAT
DYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaccggctgccagacctgacggcgtgtaggaagaatgatgatggagacacagtt
gttgtggttgagaaagatcatttcatggatgatttcttccatcaggtggaggagattaga
aacagtattgataaaataactcaatatgttgaagaagtaaagaaaaaccacagcatcatt
ctttctgcaccaaacccggaaggaaaaataaaagaagagcttgaagatctgaacaaagaa
atcaagaaaactgcgaataaaattcgagccaagttaaaggctattgaacaaagttttgat
caggatgagagtgggaaccggacttcagtggatcttcggatacgaagaacccagcattcg
gtgctgtctcggaagtttgtggaagccatggcggagtacaatgaggcacagactctgttt
cgggagcggagcaaaggccgcatccagcgccagctggagataactgggagaaccaccaca
gacgacgagctagaagagatgctggagagcgggaagccatccatcttcacttccgacatt
atatcagattcacaaattactagacaagctctcaatgaaatcgagtcacgtcacaaggac
atcatgaagctggagaccagcatccgagagttgcatgagatgttcatggacatggctatg
tttgtggagactcagggtgaaatgatcaacaacatagaaagaaatgttatgaatgccaca
gactatgtagaacacgctaaagaagaaacaaaaaaagctatcaaatatcagagcaaggca
agaaggaaaaagtggataattattgctgtgtcagtggttctggttgccataatcgctcta
attattggcttgtcagttggcaaatga

DBGET integrated database retrieval system