KEGG   Homo sapiens (human): 2098
Entry
2098              CDS       T01001                                 

Gene name
ESD, FGH
Definition
(RefSeq) esterase D
  KO
K01070  S-formylglutathione hydrolase [EC:3.1.2.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.12  S-formylglutathione hydrolase
     2098 (ESD)
SSDB
Motif
Pfam: Esterase Peptidase_S9 Chlorophyllase2 Hydrolase_4 AXE1 Esterase_PHB Chlorophyllase Abhydrolase_3 Abhydrolase_2 Lipase_3
Other DBs
NCBI-GeneID: 2098
NCBI-ProteinID: NP_001975
OMIM: 133280
HGNC: 3465
Ensembl: ENSG00000139684
Vega: OTTHUMG00000016878
Pharos: P10768(Tbio)
UniProt: P10768 A0A140VJJ2
Structure
PDB: 
3FCX

Position
13q14.2
AA seq 282 aa
MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQN
FISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRM
YSYVTEELPQLINANFPVDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVL
CPWGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFI
AACTEKKIPVVFRLQEGYDHSYYFIATFITDHIRHHAKYLNA
NT seq 849 nt   +upstreamnt  +downstreamnt
atggcattgaagcagatttccagcaacaagtgctttgggggattgcagaaagtttttgaa
catgacagtgttgaactaaactgcaaaatgaaatttgctgtctacttaccaccaaaggca
gaaacaggaaagtgccctgcactgtattggctctcaggtttaacttgcacagagcaaaat
tttatatcaaaatctggttatcatcagtctgcttcagaacatggtcttgttgtcattgct
ccagataccagccctcgtggctgcaatattaaaggtgaagatgagagctgggactttggc
actggtgctggattttatgttgatgccactgaagatccttggaaaaccaactacagaatg
tactcttatgtcacagaggagcttccccaactcataaatgccaattttccagtggatccc
caaaggatgtctatttttggccactccatgggaggtcatggagctctgatctgtgctttg
aaaaatcctggaaaatacaaatctgtgtcagcatttgctccaatttgcaaccctgtactc
tgtccctggggcaaaaaagcctttagtggatatttgggaacagatcaaagtaaatggaag
gcttatgatgctacccaccttgtgaaatcctatccaggatctcagctggacatactaatt
gatcaagggaaagatgaccagtttcttttagatggacagttactccctgataacttcata
gctgcctgtacagaaaagaaaatccccgttgtttttcgattgcaagagggttatgatcat
agctactacttcattgcaacctttattactgaccacatcagacatcatgctaaatacctg
aatgcatga

DBGET integrated database retrieval system